SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for NP_001170929.1.45394 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001170929.1.45394
Domain Number 1 Region: 465-720
Classification Level Classification E-value
Superfamily YWTD domain 3.27e-55
Family YWTD domain 0.00000431
Further Details:      
 
Domain Number 2 Region: 164-408
Classification Level Classification E-value
Superfamily YWTD domain 2.62e-51
Family YWTD domain 0.00000184
Further Details:      
 
Domain Number 3 Region: 767-1020
Classification Level Classification E-value
Superfamily YWTD domain 1.57e-37
Family YWTD domain 0.0000556
Further Details:      
 
Domain Number 4 Region: 1-113
Classification Level Classification E-value
Superfamily YWTD domain 1.44e-21
Family YWTD domain 0.00025
Further Details:      
 
Domain Number 5 Region: 1073-1113
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000183
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 6 Region: 1114-1150
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000209
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 7 Region: 1152-1187
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000115
Family LDL receptor-like module 0.002
Further Details:      
 
Domain Number 8 Region: 421-466
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000136
Family EGF-type module 0.0073
Further Details:      
 
Domain Number 9 Region: 723-770
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000367
Family EGF-type module 0.067
Further Details:      
 
Domain Number 10 Region: 118-163
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000093
Family EGF-type module 0.0088
Further Details:      
 
Domain Number 11 Region: 1031-1083
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000015
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_001170929.1.45394
Sequence length 1430
Comment low-density lipoprotein receptor-related protein 5 [Danio rerio]; AA=GCF_000002035.6; RF=reference genome; TAX=7955; STAX=7955; NAME=Danio rerio; AL=Chromosome; RT=Major
Sequence
MDGSNRQIIVQKQIYWPNGLTIDLDEQKLYWADAKLSFIHRANLDGTSREAVVEGSLTHP
FALTLYDETLYWTDWQTRSIHACNKHSGEKHREILNGIYSPMDIQVLGQERQPNIQTPCS
ERNGGCSHLCLLSPIPPFYSCACPTGVKLKEDGKTCRPGAEQVLLLARRTDLRRISLDLP
DFTDIVLQVNDIRHAIAIDYDPVEGYVYWTDDELRAIRRARIDGSDAQTLITNEINHPDG
IAVDWVARNLYWTDTGTDRIEVTRLNGTSRRVLISENLDEPRAIVLDPINGYMYWTDWGE
LPKIERANLDGTDRVVLLNTSLGWPNGLAIDYIAGKLYWGDAKTDKIEVINVDGTNRMTI
LEDKLPHIFGFTLLGEYIYWTDWQRRSIERVHIANSTREVIVEQLPDLMGLKATKVMEAE
GTNGCAENNGGCSHLCFHRPQGLSCACPMGLELLSDLRTCVVPEAFLLFTNRADIRSISL
GTNSNDVPIPLTGVKEASALDFDVLENRIYWTDVSTKTISRAFMNGSSVEPVIEFGLDYP
EGMAVDWMGRNLYWADTGTNRIEVARLDGQYRQVLVCKDLDNPRSLALDPANGYMYWTEW
GGRPRIARAHMDGSNIVTLVDKVGRANGLTIDYIDQRLYWTDLDTCMIESTNMQSLQREI
VADDLPHPFGLTQYRDYIYWTDWNLRSIERADKRSGLNRTVVQGHLEYVMDILVFHSSRQ
DGANDCSQNNGQCAHLCLASPSGAQCRCASHYTLEANGRNCSSPSSFLLFSQKSSISRMV
LGEQSPDMILPIHVMKNLRAISFDPLERLVYWVDGRQNIRRSRDDGTQASTVMTPNSDHP
KQPHDLSLDPYSRTVYWTCETTNTINIHRMDGHVIGEVLKDDVDKPRAIVVNAEKGYMYF
TTVQERSAKIEGASLDGTERESLFTTSLIRPVALALDNKLGKLFWVDADLKRIESSDLSG
ANRIVLQDSNILQPVGLTVLGDHLYWIDKQQQMIERVDKLTGEKRTRIQGRLQYLTGIHA
VQYMETDEFATHPCSRDNGGCSHICIAKGDGTPRCSCPMHLVLLQNLLSCGEPPTCSSEQ
FTCATGEIDCIPMAWRCDGIAECADNSDEMNCPICSKLQFQCDKGQCVDIQVRCNGEPDC
ADGSDEQDCETICLSNQFRCGNSQCILKKQQCDSFPDCTDESDERFCDFPPPPNDLPRHT
STIGPVIGIILSVFVMGGMCFVCQRVVCRHYKGPNGGFPHEYISGTPHVPLNFIAPTNSQ
HGKGISCGKSMMSSVSLMGSSSSGAPLYDRNHVTGASSSSSSSTKGAFYPQMLNPPPSPA
TDRSLYNAEVFYSSNSPSTTRSYRPYLMRGVAPPTTPCSTDVCDSDYTTSRWKSNKYYMD
LNSDSDPYPPPPTPRSQYMSAEESCPPSPSTERSYFHLCPPPPSPCTDSS
Download sequence
Identical sequences D0EWS1
NP_001170929.1.45394

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]