SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for NP_001171479.1.92137 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001171479.1.92137
Domain Number 1 Region: 52-395
Classification Level Classification E-value
Superfamily Tryptophan synthase beta subunit-like PLP-dependent enzymes 5.11e-102
Family Tryptophan synthase beta subunit-like PLP-dependent enzymes 0.00000000000263
Further Details:      
 
Domain Number 2 Region: 413-543
Classification Level Classification E-value
Superfamily CBS-domain pair 0.00000000000000639
Family CBS-domain pair 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_001171479.1.92137
Sequence length 551
Comment cystathionine beta-synthase isoform 1 [Homo sapiens]; AA=GCF_000001405.37; RF=reference genome; TAX=9606; STAX=9606; NAME=Homo sapiens; AL=Chromosome; RT=Patch
Sequence
MPSETPQAEVGPTGCPHRSGPHSAKGSLEKGSPEDKEAKEPLWIRPDAPSRCTWQLGRPA
SESPHHHTAPAKSPKILPDILKKIGDTPMVRINKIGKKFGLKCELLAKCEFFNAGGSVKD
RISLRMIEDAERDGTLKPGDTIIEPTSGNTGIGLALAAAVRGYRCIIVMPEKMSSEKVDV
LRALGAEIVRTPTNARFDSPESHVGVAWRLKNEIPNSHILDQYRNASNPLAHYDTTADEI
LQQCDGKLDMLVASVGTGGTITGIARKLKEKCPGCRIIGVDPEGSILAEPEELNQTEQTT
YEVEGIGYDFIPTVLDRTVVDKWFKSNDEEAFTFARMLIAQEGLLCGGSAGSTVAVAVKA
AQELQEGQRCVVILPDSVRNYMTKFLSDRWMLQKGFLKEEDLTEKKPWWWHLRVQELGLS
APLTVLPTITCGHTIEILREKGFDQAPVVDEAGVILGMVTLGNMLSSLLAGKVQPSDQVG
KVIYKQFKQIRLTDTLGRLSHILEMDHFALVVHEQIQYHSTGKSSQRQMVFGVVTAIDLL
NFVAAQERDQK
Download sequence
Identical sequences P0DN79 P35520
ENSP00000344460 ENSP00000352643 ENSP00000381225 ENSP00000381231 ENSP00000344460 ENSP00000352643 ENSP00000381225 ENSP00000381231 ENSP00000381234 ENSP00000479559 ENSP00000481719 9606.ENSP00000344460 NP_000062.1.87134 NP_000062.1.92137 NP_001171479.1.87134 NP_001171479.1.92137 NP_001171480.1.87134 NP_001171480.1.92137 NP_001307227.1.87134 NP_001307227.1.92137 NP_001308002.1.92137 XP_011544401.1.92137 XP_016883703.1.92137 XP_016883704.1.92137 XP_016883705.1.92137 XP_016883706.1.92137 XP_016883707.1.92137 XP_016883979.1.92137 XP_016883980.1.92137 XP_016883981.1.92137 gi|295821200|ref|NP_001171479.1| gi|295821202|ref|NP_001171480.1| gi|4557415|ref|NP_000062.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]