SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001177931.1.87134 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001177931.1.87134
Domain Number 1 Region: 24-123
Classification Level Classification E-value
Superfamily Thioredoxin-like 6.73e-28
Family Glutathione S-transferase (GST), N-terminal domain 0.0000172
Further Details:      
 
Domain Number 2 Region: 103-205
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 1.64e-24
Family Glutathione S-transferase (GST), C-terminal domain 0.00000189
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_001177931.1.87134
Sequence length 208
Comment glutathione S-transferase omega-1 isoform 2 [Homo sapiens]; AA=GCF_000306695.2; RF=na; TAX=9606; STAX=9606; NAME=Homo sapiens; AL=Chromosome; RT=Major
Sequence
MSGESARSLGKGSAPPGPVPEGSIRIYSMRFCPFAERTRLVLKAKGIRHEVININLKNKP
EWFFKKNPFGLVPVLENSQGQLIYESAITCEYLDEAYPGKKLLPDDPYEKACQKMILELF
SKVLTNKKTTFFGGNSISMIDYLIWPWFERLEAMKLNECVDHTPKLKLWMAAMKEDPTVS
ALLTSEKDWQGFLELYLQNSPEACDYGL
Download sequence
Identical sequences gi|300360532|ref|NP_001177931.1| NP_001177931.1.87134 NP_001177931.1.92137 ENSP00000358724 ENSP00000358724

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]