SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for NP_001178600.1.100692 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001178600.1.100692
Domain Number 1 Region: 50-500
Classification Level Classification E-value
Superfamily Seven-hairpin glycosidases 1.57e-144
Family Class I alpha-1;2-mannosidase, catalytic domain 0.0000011
Further Details:      
 
Domain Number 2 Region: 701-779
Classification Level Classification E-value
Superfamily PA domain 0.0000000288
Family PA domain 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_001178600.1.100692
Sequence length 932
Comment ER degradation-enhancing alpha-mannosidase-like 3 [Rattus norvegicus]; AA=GCF_000001895.5; RF=representative genome; TAX=10116; STAX=10116; NAME=Rattus norvegicus; strain=mixed; AL=Chromosome; RT=Major
Sequence
MSEAGGGRGCGCRVPQRASWSLVAATAALYLMLATTVCTAGAAPMSREEKQKLGNQVLEM
FDHAYGNYMEHAYPADELMPLTCRGRVRGQEPSRGDVDDALGKFSLTLIDSLDTLVVLNK
TKEFEDAVRKVLRDVNLDNDVVVSVFETNIRVLGGLLGGHSLAIMLKEKGEYMQWYNDEL
LQMAKQLGYKLLPAFNTTSGLPYPRINLKFGIRKPEARTGTETDTCTACAGTLILEFAAL
SRFTGATVFEEYARKALDFLWEKRQRSSNLVGVTINIHTGDWVRKDSGVGAGIDSYYEYL
LKAYVLLGDDSFLERFNTHYDAIMRYISQPPLLLDVHIHKPMLNARTWMDALLAFFPGLQ
VLKGDIRPAIETHEMLYQVIKKHNFLPEAFTTDFRVHWAQHPLRPEFAESTYFLYKATGD
PYYLEVGKTLIENLNKYARVPCGFAAMKDVRTGSHEDRMDSFFLAEMFKYLYLLFADKED
IIFDIEDYIFTTEAHLLPLWLSTTNRNISKKNTTSEYTELDDSNFDWTCPNTQILFPNDP
LYAQSIREPLKNVVDKSCPRGIIRVEESFRSGAKPPLRARDFMATNPEHLEILKKMGVSL
IHLKDGRVQLVQHAIQAASSVDAEDGLRFMQEMIELSSQQQKEQQLPPRAVQIISHPFFG
RVVLTAGPAQFGLDLSKHKETRGFVASSKPYNGCSELTNPEAVMGKIALIQRGQCMFAEK
ARNIQNAGAIGGIVIDDNEGSSSDTAPLFQMAGDGKDTDDIKIPMLFLFSKEGSIILDAI
REHEQVEVLLSDKARDRDPEVENEDQPSSENDSQNQSAEQMLPLPQTVGLADQESPGNPL
ESPSEPPSPADSEEAAGFAPSEQISSPTETQETAGLDGECTDLDNQLQDQPETEEDPSPN
VSWGTKAQPMDSILADWNEDIEAFEMMEKDEL
Download sequence
Identical sequences ENSRNOP00000017858 10116.ENSRNOP00000017858 NP_001178600.1.100692 NP_001178600.1.4139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]