SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001180057.1.59421 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001180057.1.59421
Domain Number 1 Region: 16-175
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 7.48e-40
Family Dual specificity phosphatase-like 0.0005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_001180057.1.59421
Sequence length 223
Comment serine/threonine/tyrosine-interacting protein [Bos taurus]; AA=GCF_000003205.7; RF=na; TAX=9913; STAX=9913; NAME=Bos taurus; breed=Hereford; AL=Chromosome; RT=Major
Sequence
MEDVKLEFPSLPQCKEDAEEWTYPMRREMQEILPGLFLGPYSSAMKSKLPILQKHGITHI
ICIRQNIEANFIKPNFQQLFRYLVLDIADNPVENIIRFFPMTKEFIDESLQSGGKVLVHG
NAGISRSAAFVIAYIMETFGMKYRDAFAYVQERRFCINPNAGFVHQLQEYEAIYLAKLTI
QMMSPLQIERSLSVHSGSTGSLKRTHEEEDDFGNMQVAAAQNG
Download sequence
Identical sequences G3MYQ0 L8IA43
ENSBTAP00000054687 ENSBTAP00000054687 NP_001180057.1.59421 NP_001180057.1.76553 XP_005900018.1.15283 XP_019823675.1.53367

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]