SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for NP_001182461.1.92137 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001182461.1.92137
Domain Number 1 Region: 741-888
Classification Level Classification E-value
Superfamily Spectrin repeat 4.89e-39
Family Spectrin repeat 0.00011
Further Details:      
 
Domain Number 2 Region: 203-357
Classification Level Classification E-value
Superfamily Spectrin repeat 9.82e-37
Family Spectrin repeat 0.00017
Further Details:      
 
Domain Number 3 Region: 1799-1954
Classification Level Classification E-value
Superfamily Spectrin repeat 9.03e-35
Family Spectrin repeat 0.00000193
Further Details:      
 
Domain Number 4 Region: 521-674
Classification Level Classification E-value
Superfamily Spectrin repeat 4.26e-34
Family Spectrin repeat 0.0000517
Further Details:      
 
Domain Number 5 Region: 1479-1634
Classification Level Classification E-value
Superfamily Spectrin repeat 6.45e-33
Family Spectrin repeat 0.00013
Further Details:      
 
Domain Number 6 Region: 1267-1404
Classification Level Classification E-value
Superfamily Spectrin repeat 1.25e-32
Family Spectrin repeat 0.00094
Further Details:      
 
Domain Number 7 Region: 309-462
Classification Level Classification E-value
Superfamily Spectrin repeat 1.05e-31
Family Spectrin repeat 0.00068
Further Details:      
 
Domain Number 8 Region: 1710-1842
Classification Level Classification E-value
Superfamily Spectrin repeat 1.33e-31
Family Spectrin repeat 0.00000223
Further Details:      
 
Domain Number 9 Region: 12-145
Classification Level Classification E-value
Superfamily Spectrin repeat 1.66e-30
Family Spectrin repeat 0.0000147
Further Details:      
 
Domain Number 10 Region: 1904-2059
Classification Level Classification E-value
Superfamily Spectrin repeat 9.55e-29
Family Spectrin repeat 0.00094
Further Details:      
 
Domain Number 11 Region: 1641-1743
Classification Level Classification E-value
Superfamily Spectrin repeat 3.52e-26
Family Spectrin repeat 0.00000153
Further Details:      
 
Domain Number 12 Region: 2066-2179
Classification Level Classification E-value
Superfamily Spectrin repeat 4.32e-26
Family Spectrin repeat 0.00029
Further Details:      
 
Domain Number 13 Region: 2288-2445
Classification Level Classification E-value
Superfamily EF-hand 5.88e-24
Family Calmodulin-like 0.0041
Further Details:      
 
Domain Number 14 Region: 2181-2296
Classification Level Classification E-value
Superfamily Spectrin repeat 1.31e-20
Family Spectrin repeat 0.00079
Further Details:      
 
Domain Number 15 Region: 967-1028
Classification Level Classification E-value
Superfamily SH3-domain 6.69e-20
Family SH3-domain 0.0000384
Further Details:      
 
Domain Number 16 Region: 1037-1144
Classification Level Classification E-value
Superfamily Spectrin repeat 1.86e-19
Family Spectrin repeat 0.0013
Further Details:      
 
Domain Number 17 Region: 889-960
Classification Level Classification E-value
Superfamily Spectrin repeat 2.88e-19
Family Spectrin repeat 0.001
Further Details:      
 
Weak hits

Sequence:  NP_001182461.1.92137
Domain Number - Region: 1188-1212
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0555
Family Spectrin repeat 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_001182461.1.92137
Sequence length 2452
Comment spectrin alpha chain, non-erythrocytic 1 isoform 3 [Homo sapiens]; AA=GCF_000001405.37; RF=reference genome; TAX=9606; STAX=9606; NAME=Homo sapiens; AL=Chromosome; RT=Patch
Sequence
MDPSGVKVLETAEDIQERRQQVLDRYHRFKELSTLRRQKLEDSYRFQFFQRDAEELEKWI
QEKLQIASDENYKDPTNLQGKLQKHQAFEAEVQANSGAIVKLDETGNLMISEGHFASETI
RTRLMELHRQWELLLEKMREKGIKLLQAQKLVQYLRECEDVMDWINDKEAIVTSEELGQD
LEHVEVLQKKFEEFQTDMAAHEERVNEVNQFAAKLIQEQHPEEELIKTKQDEVNAAWQRL
KGLALQRQGKLFGAAEVQRFNRDVDETISWIKEKEQLMASDDFGRDLASVQALLRKHEGL
ERDLAALEDKVKALCAEADRLQQSHPLSATQIQVKREELITNWEQIRTLAAERHARLNDS
YRLQRFLADFRDLTSWVTEMKALINADELASDVAGAEALLDRHQEHKGEIDAHEDSFKSA
DESGQALLAAGHYASDEVREKLTVLSEERAALLELWELRRQQYEQCMDLQLFYRDTEQVD
NWMSKQEAFLLNEDLGDSLDSVEALLKKHEDFEKSLSAQEEKITALDEFATKLIQNNHYA
MEDVATRRDALLSRRNALHERAMRRRAQLADSFHLQQFFRDSDELKSWVNEKMKTATDEA
YKDPSNLQGKVQKHQAFEAELSANQSRIDALEKAGQKLIDVNHYAKDEVAARMNEVISLW
KKLLEATELKGIKLREANQQQQFNRNVEDIELWLYEVEGHLASDDYGKDLTNVQNLQKKH
ALLEADVAAHQDRIDGITIQARQFQDAGHFDAENIKKKQEALVARYEALKEPMVARKQKL
ADSLRLQQLFRDVEDEETWIREKEPIAASTNRGKDLIGVQNLLKKHQALQAEIAGHEPRI
KAVTQKGNAMVEEGHFAAEDVKAKLHELNQKWEALKAKASQRRQDLEDSLQAQQYFADAN
EAESWMREKEPIVGSTDYGKDEDSAEALLKKHEALMSDLSAYGSSIQALREQAQSCRQQV
APTDDETGKELVLALYDYQEKSPREVTMKKGDILTLLNSTNKDWWKVEVNDRQGFVPAAY
VKKLDPAQSASRENLLEEQGSIALRQEQIDNQYHSLLELGEKRKGMLEKSCKKFMLFREA
NELQQWINEKEAALTSEEVGADLEQVEVLQKKFDDFQKDLKANESRLKDINKVAEDLESE
GLMAEEVQAVQQQEVYGMMPRDETDSKTASPWKSARLMVHTVATFNSIKELNERWRSLQQ
LAEERSQLLGSAHEVQRFHRDADETKEWIEEKNQALNTDNYGHDLASVQALQRKHEGFER
DLAALGDKVNSLGETAERLIQSHPESAEDLQEKCTELNQAWSSLGKRADQRKAKLGDSHD
LQRFLSDFRDLMSWINGIRGLVSSDELAKDVTGAEALLERHQEHRTEIDARAGTFQAFEQ
FGQQLLAHGHYASPEIKQKLDILDQERADLEKAWVQRRMMLDQCLELQLFHRDCEQAENW
MAAREAFLNTEDKGDSLDSVEALIKKHEDFDKAINVQEEKIAALQAFADQLIAAGHYAKG
DISSRRNEVLDRWRRLKAQMIEKRSKLGESQTLQQFSRDVDEIEAWISEKLQTASDESYK
DPTNIQSKHQKHQAFEAELHANADRIRGVIDMGNSLIERGACAGSEDAVKARLAALADQW
QFLVQKSAEKSQKLKEANKQQNFNTGIKDFDFWLSEVEALLASEDYGKDLASVNNLLKKH
QLLEADISAHEDRLKDLNSQADSLMTSSAFDTSQVKDKRDTINGRFQKIKSMAASRRAKL
NESHRLHQFFRDMDDEESWIKEKKLLVGSEDYGRDLTGVQNLRKKHKRLEAELAAHEPAI
QGVLDTGKKLSDDNTIGKEEIQQRLAQFVEHWKELKQLAAARGQRLEESLEYQQFVANVE
EEEAWINEKMTLVASEDYGDTLAAIQGLLKKHEAFETDFTVHKDRVNDVCTNGQDLIKKN
NHHEENISSKMKGLNGKVSDLEKAAAQRKAKLDENSAFLQFNWKADVVESWIGEKENSLK
TDDYGRDLSSVQTLLTKQETFDAGLQAFQQEGIANITALKDQLLAAKHVQSKAIEARHAS
LMKRWSQLLANSAARKKKLLEAQSHFRKVEDLFLTFAKKASAFNSWFENAEEDLTDPVRC
NSLEEIKALREAHDAFRSSLSSAQADFNQLAELDRQIKSFRVASNPYTWFTMEALEETWR
NLQKIIKERELELQKEQRRQEENDKLRQEFAQHANAFHQWIQETRTYLLDGSCMVEESGT
LESQLEATKRKHQEIRAMRSQLKKIEDLGAAMEEALILDNKYTEHSTVGLAQQWDQLDQL
GMRMQHNLEQQIQARNTTGVTEEALKEFSMMFKHFDKDKSGRLNHQEFKSCLRSLGYDLP
MVEEGEPDPEFEAILDTVDPNRDGHVSLQEYMAFMISRETENVKSSEEIESAFRALSSEG
KPYVTKEELYQNLTREQADYCVSHMKPYVDGKGRELPTAFDYVEFTRSLFVN
Download sequence
Identical sequences gi|306966132|ref|NP_001182461.1| NP_001182461.1.87134 NP_001182461.1.92137 ENSP00000350882

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]