SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for NP_001183800.1.34533 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001183800.1.34533
Domain Number 1 Region: 113-251
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 6.8e-43
Family B3 DNA binding domain 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_001183800.1.34533
Sequence length 511
Comment uncharacterized protein LOC100502393 [Zea mays]; AA=GCF_000005005.2; RF=representative genome; TAX=4577; STAX=4577; NAME=Zea mays; cultivar=B73; AL=Chromosome; RT=Major
Sequence
MASAGVAGCSGSAGDALFRELWHACAGPLVTVPRQGELVYYFPQGHMEQLEASTDQQLDQ
HLPLFDLPPKILCKVVNVELRAETDSDEVYAQIMLQPEADQSEPTSPDSEPPEPERCNVY
SFCKTLTASDTSTHGGFSVLRRHAEECLPQLDMTQNPPWQELLAKDLHGNEWHFRHIFRG
QPRRHLLTTGWSVFVSSKRLVAGDAFIFLRGENGELRVGVRRLMRQLNNMPSSVISSHNM
HLGVLATASHAISTGTLFSVFYKPRTSRSEFVVSVNKYLEAKNHKVSVGMRFKMRFEGDE
SPERRLSGTIIGLGSMPANSTSPWANSDWRSLRVQWDEPSAILRPDRVSPWELEPLDATN
PQPPQPHLRNKRARPPALLSIAPELPQVFGFLKSPAEPAQAFSFSRPQQTQELYHSNPSS
IFSSSLNVGFSSKNDRSTPINSHLYWTMRQTRTESYSASINKAPTEKKQESATSGCRLFG
IEIGSAVSPVATVASVGQDQPPALSVDVESD
Download sequence
Identical sequences C4JAZ4 K0DCS1
NP_001183800.1.34533 GRMZM2G137413_T01|PACid:20861070 GRMZM2G137413_P01

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]