SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for NP_001185688.1.87134 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001185688.1.87134
Domain Number 1 Region: 210-348
Classification Level Classification E-value
Superfamily C-type lectin-like 1.1e-33
Family C-type lectin domain 0.00078
Further Details:      
 
Domain Number 2 Region: 350-487
Classification Level Classification E-value
Superfamily C-type lectin-like 3.37e-33
Family C-type lectin domain 0.00064
Further Details:      
 
Domain Number 3 Region: 1372-1515
Classification Level Classification E-value
Superfamily C-type lectin-like 1.05e-28
Family C-type lectin domain 0.0023
Further Details:      
 
Domain Number 4 Region: 949-1092
Classification Level Classification E-value
Superfamily C-type lectin-like 1.62e-27
Family C-type lectin domain 0.0036
Further Details:      
 
Domain Number 5 Region: 1534-1662
Classification Level Classification E-value
Superfamily C-type lectin-like 7.35e-27
Family C-type lectin domain 0.0007
Further Details:      
 
Domain Number 6 Region: 1107-1223
Classification Level Classification E-value
Superfamily C-type lectin-like 6.65e-26
Family C-type lectin domain 0.0008
Further Details:      
 
Domain Number 7 Region: 635-792
Classification Level Classification E-value
Superfamily C-type lectin-like 6.75e-25
Family C-type lectin domain 0.0011
Further Details:      
 
Domain Number 8 Region: 33-155
Classification Level Classification E-value
Superfamily Ricin B-like lectins 1.18e-24
Family Cysteine rich domain 0.0093
Further Details:      
 
Domain Number 9 Region: 1662-1795
Classification Level Classification E-value
Superfamily C-type lectin-like 2.97e-22
Family C-type lectin domain 0.0036
Further Details:      
 
Domain Number 10 Region: 501-627
Classification Level Classification E-value
Superfamily C-type lectin-like 2.62e-19
Family C-type lectin domain 0.0018
Further Details:      
 
Domain Number 11 Region: 1239-1359
Classification Level Classification E-value
Superfamily C-type lectin-like 1.75e-18
Family C-type lectin domain 0.0059
Further Details:      
 
Domain Number 12 Region: 818-932
Classification Level Classification E-value
Superfamily C-type lectin-like 4.05e-16
Family C-type lectin domain 0.019
Further Details:      
 
Domain Number 13 Region: 154-210
Classification Level Classification E-value
Superfamily Kringle-like 0.00000000000000131
Family Fibronectin type II module 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_001185688.1.87134
Sequence length 1873
Comment LY75-CD302 fusion protein isoform 1 precursor [Homo sapiens]; AA=GCF_000306695.2; RF=na; TAX=9606; STAX=9606; NAME=Homo sapiens; AL=Chromosome; RT=Major
Sequence
MRTGWATPRRPAGLLMLLFWFFDLAEPSGRAANDPFTIVHGNTGKCIKPVYGWIVADDCD
ETEDKLWKWVSQHRLFHLHSQKCLGLDITKSVNELRMFSCDSSAMLWWKCEHHSLYGAAR
YRLALKDGHGTAISNASDVWKKGGSEESLCDQPYHEIYTRDGNSYGRPCEFPFLIDGTWH
HDCILDEDHSGPWCATTLNYEYDRKWGICLKPENGCEDNWEKNEQFGSCYQFNTQTALSW
KEAYVSCQNQGADLLSINSAAELTYLKEKEGIAKIFWIGLNQLYSARGWEWSDHKPLNFL
NWDPDRPSAPTIGGSSCARMDAESGLWQSFSCEAQLPYVCRKPLNNTVELTDVWTYSDTR
CDAGWLPNNGFCYLLVNESNSWDKAHAKCKAFSSDLISIHSLADVEVVVTKLHNEDIKEE
VWIGLKNINIPTLFQWSDGTEVTLTYWDENEPNVPYNKTPNCVSYLGELGQWKVQSCEEK
LKYVCKRKGEKLNDASSDKMCPPDEGWKRHGETCYKIYEDEVPFGTNCNLTITSRFEQEY
LNDLMKKYDKSLRKYFWTGLRDVDSCGEYNWATVGGRRRAVTFSNWNFLEPASPGGCVAM
STGKSVGKWEVKDCRSFKALSICKKMSGPLGPEEASPKPDDPCPEGWQSFPASLSCYKVF
HAERIVRKRNWEEAERFCQALGAHLSSFSHVDEIKEFLHFLTDQFSGQHWLWIGLNKRSP
DLQGSWQWSDRTPVSTIIMPNEFQQDYDIRDCAAVKVFHRPWRRGWHFYDDREFIYLRPF
ACDTKLEWVCQIPKGRTPKTPDWYNPDRAGIHGPPLIIEGSEYWFVADLHLNYEEAVLYC
ASNHSFLATITSFVGLKAIKNKIANISGDGQKWWIRISEWPIDDHFTYSRYPWHRFPVTF
GEECLYMSAKTWLIDLGKPTDCSTKLPFICEKYNVSSLEKYSPDSAAKVQCSEQWIPFQN
KCFLKIKPVSLTFSQASDTCHSYGGTLPSVLSQIEQDFITSLLPDMEATLWIGLRWTAYE
KINKWTDNRELTYSNFHPLLVSGRLRIPENFFEEESRYHCALILNLQKSPFTGTWNFTSC
SERHFVSLCQKYSEVKSRQTLQNASETVKYLNNLYKIIPKTLTWHSAKRECLKSNMQLVS
ITDPYQQAFLSVQALLHNSSLWIGLFSQDDELNFGWSDGKRLHFSRWAETNGQLEDCVVL
DTDGFWKTVDCNDNQPGAICYYSGNETEKEVKPVDSVKCPSPVLNTPWIPFQNCCYNFII
TKNRHMATTQDEVHTKCQKLNPKSHILSIRDEKENNFVLEQLLYFNYMASWVMLGITYRN
KSLMWFDKTPLSYTHWRAGRPTIKNEKFLAGLSTDGFWDIQTFKVIEEAVYFHQHSILAC
KIEMVDYKEEYNTTLPQFMPYEDGIYSVIQKKVTWYEALNMCSQSGGHLASVHNQNGQLF
LEDIVKRDGFPLWVGLSSHDGSESSFEWSDGSTFDYIPWKGQTSPGNCVLLDPKGTWKHE
KCNSVKDGAICYKPTKSKKLSRLTYSSRCPAAKENGSRWIQYKGHCYKSDQALHSFSEAK
KLCSKHDHSATIVSIKDEDENKFVSRLMRENNNITMRVWLGLSQHSVDQSWSWLDGSEVT
FVKWENKSKSGVGRCSMLIASNETWKKVECEHGFGRVVCKVPLDCPSSTWIQFQDSCYIF
LQEAIKVESIEDVRNQCTDHGADMISIHNEEENAFILDTLKKQWKGPDDILLGMFYDTDD
ASFKWFDNSNMTFDKWTDQDDDEDLVDTCAFLHIKTGEWKKGNCEVSSVEGTLCKTAIPY
KRKYLSDNHILISALVIASTVILTVLGAIIWFLYKKHSDSRFTTVFSTAPQSPYNEDCVL
VVGEENEYPVQFD
Download sequence
Identical sequences ENSP00000423463 ENSP00000451511 ENSP00000423463 gi|311771583|ref|NP_001185688.1| ENSP00000423463 ENSP00000451511 NP_001185688.1.87134 NP_001185688.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]