SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for NP_001247302.1.81976 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001247302.1.81976
Domain Number 1 Region: 1306-1446
Classification Level Classification E-value
Superfamily PH domain-like 3.13e-40
Family Ran-binding domain 0.00016
Further Details:      
 
Domain Number 2 Region: 1608-1738
Classification Level Classification E-value
Superfamily PH domain-like 3.24e-38
Family Ran-binding domain 0.0000984
Further Details:      
 
Domain Number 3 Region: 2020-2147
Classification Level Classification E-value
Superfamily PH domain-like 1.15e-37
Family Ran-binding domain 0.00015
Further Details:      
 
Domain Number 4 Region: 2557-2695
Classification Level Classification E-value
Superfamily PH domain-like 1.78e-34
Family Ran-binding domain 0.00041
Further Details:      
 
Domain Number 5 Region: 32-110
Classification Level Classification E-value
Superfamily TPR-like 0.000000542
Family Tetratricopeptide repeat (TPR) 0.024
Further Details:      
 
Domain Number 6 Region: 1771-1797
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.0000942
Family Ran binding protein zinc finger-like 0.0029
Further Details:      
 
Weak hits

Sequence:  NP_001247302.1.81976
Domain Number - Region: 1892-1917
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.000659
Family Ran binding protein zinc finger-like 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_001247302.1.81976
Sequence length 2718
Comment nucleoporin 358kD, isoform B [Drosophila melanogaster]; AA=GCF_000001215.4; RF=reference genome; TAX=7227; STAX=7227; NAME=Drosophila melanogaster; AL=Chromosome; RT=Major
Sequence
MFTTRKEVDAHVHKMLGKLQPGRERDIKGLAVARLYMKVQEYPKAIEYLNGYLRVRDDAV
GHNMIATCYSRLNPPDVTEALQHYQRSIQIDPRQSEVVIDACELLVKENNASITECARYW
LDQANSLDLSGNKQVFNLRMRVNLADSNGERDDTSGGDGEQNTLEILMYKELQARPQDVN
IRIQLLRSYVEKMKIDQAFNYALKTELESKNCTSQSNEWYEQIWMVLFKIEMAKDVKKNW
RFWHFALHTLDRLVQLSLEGSGLADSSKQLFRLDQYLFKFSTSIERSGDAPQRDLHQACI
DHFTGQLLLHAVTLIFKREVLANKNKWMSTLRSALPLLLLGYQVRPIDDSSTNQWIKHCD
AEQKQLIQMWRPQGAFRCAQLGRTLLGCLDRSQMEIKNDRENAEFDENKNSGNSMPGLFA
DSEELLASAHQQCLDKSWRSQIYQQLFTHAEHKLKDTSSHLVRNLRLQLPLFEWPNLAHI
ENYELQALVLPPHSLAQHVYLALGTDPNKLGDAPRVVFYEGFQRDVKQNLNYCGQDSISQ
VDVDLYLYATTIQTRRKLQIQREVYDSSNLGNRNAAARPHMMPFANLVGQLGAPEQSNWW
DLVVRLNSNQLITEGNRAEQRAQLQHGLEAVRGVNGPKADAIIIFQLGKILNSRSDRSSL
EARIDTLYRQGFSILRHQHNQQMESYVRVFKYGSAGSTAAWQDLQSLAEEAVTYFSEKMF
RIGQYEQFLDEVRGLHLPMAYFLQSEACHHLEESSKLPRTSRDRYSERRRECLQKTQKLI
KNDDKHPLIAAMHRHQQDRNSRGIDNSFGSPDVHNNSSAYEDAEDDFYSHAAFSANRSRR
QLEVTPVTPIVMAQPSQEMEQAVKQISKSLCVLKDDVSVGMEAMRQDIKVLTEKFTGLED
LLKKIKISSRDTPTRDVDPAAALGLDDLFIIEDALAEHQQQQQHQQQQSHNQGAIHPVVP
NPYTSGFYNGMPNTPSAQERFLQGPYGSPMFNQNQMYNYYAAQAQAQAQAQFLRTPPAPG
SIPPPNMFGPRNPNFGLPSMFPPPTVPSVAPYIDAMGNFTQPPPSLIPPPAQPAAPPAPL
NILESKPVVALPTPGFFNTTTPVFGASPIQVPQSKPLTVPTVPIPSTAPAPPIAGTVNPP
ATTAVPPPVHIPQVAPSVPAQPPAPAPVSVPSMFNRALNNQPVEKEPPANVVITSSDPLP
KPTTASVQPTLSVTIPAQHIKPSLVQAPEQPAQSAQPAQPSVSGVGSLSFNFGSKSSESP
FSFKTQVAKAAAEKQKEQEEAEQNQSGATDPNKTLPQDTSADDYDPRPDFKPIIPLPDEV
EVRTGEEGEDIKFTSRAKLFRYVDKEWKERGTGVIKILCDKATGVSRVLMRRDQTHKVCA
NHTITADITINVANQDKDKKSLLWAANDFADEQVTLERFLVRFKTGELAEEFRVAFTKAS
EAAKSKETVKPTVNTAEKGSTATAPAAFKSFVTSTPAANSLINKPQEQTKTQPNPDPPAT
AAKSLFGTLSVSAAPATSAPASATPFASFSFTPNGSSGFGTSTASPFGNLSFGTASAVGS
GNNTTLFTTALIKDNTVQGKTLQQESQLNKSNSSDAEEEYVPTAQFVPVIALPDIVEVVT
GEENEDVLFEHRAKLLRWDKEANEWKERGLGNMKLLRDRTDPNKVRLLMRREQVHKLCCN
QRLLPETKFTYATNCKAAVTWGAQDYSDEELTTALLAVRFKSQDICQQFLEAVQKAQQSI
GNEPKKEEVPSAAGEKEKPIKGFGDAFKPKAGSWNCQACYTNNGQDQLYCLACQEPKDAT
VPPKQSGLDQGNALNLTTSSSNKFSFGFASSATLPATGGFSFGGATQPKEKPAVAVVTAS
ASAPTSVQTAALGFGKSSMTSGFGDAFKPAVGSWSCSACYVNNPGESLYCSACDAPKNDT
VPQKEKSLGSGLNLPPTSKFSFGFGAAAAGDKDQAGDGATFNFAAMPAAVAPTTSIGSSS
FTFSMTKPKPDQQQPNSTAAKEDEDNDSQEVEEEENNTYFSPVIPLPDKIDVKTGEEDEE
LLYVHKAKLYRLNESDWKERGLGDVKILRHRQTKKLRVVMRREQVFKICLNHVLNENVVY
REKTETSWMFAVHDFSEGESVLERFTLRFKNKEVAQGFMEAIKNALNETAKPIEDSPVVG
SVSQSTEANKPSQKNDGAAKSRGGESEVLDVGKTSSVRPTTHEVIPPLPMTLPLLTLPQP
LAKPNDYQTPATILFKGSSLSRNNSSASEASKTPSSAFIFGSTDKSEPGKDAGPLANLQK
LASGEGQGNVLGSIFRSGSSNENSSDGSVKFFFGGGNKAAEQQKKDSSESVFGGNKADSQ
SPATQEAPKLAFGGIAAPVFGDANPFGGHKVNLQKSDGKEEPKSIIGGTPLLFGGSNAFG
IPKIETQSPAKDFVFGSAPAFGQMATFSFTAAKNEKEKDITSNNTTDLKAEGKEKKELVP
ETTSTFADLAKTGSTFADLASNPGGTFADLANKTGNDFANLSANSQGTTVGFNKSAGGGF
YNLTHQNAFKNFESPQATEECDDDGDATTDDNYDPHYDAIVELPDEIVVTTGEENETKLF
GERAKLYRYDAESKQWKERGVGEIKVLEHPELQTFRLIMRQEQIHKLVLNMNISASLQMD
YMNAQMKSFLWAGYNYAVDAEGKVDTEGVLERLACRFAKEEIASEFLNTVNSCIKRAKAL
QGDEENKNDDAPEEQASS
Download sequence
Identical sequences A0A0B4K7J2
NP_001247302.1.81976 FBpp0293235 FBpp0293235

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]