SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for NP_001252967.1.72884 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001252967.1.72884
Domain Number 1 Region: 131-260
Classification Level Classification E-value
Superfamily PH domain-like 7.38e-35
Family Phosphotyrosine-binding domain (PTB) 0.0000284
Further Details:      
 
Domain Number 2 Region: 7-110
Classification Level Classification E-value
Superfamily PH domain-like 1.67e-17
Family Phosphotyrosine-binding domain (PTB) 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_001252967.1.72884
Sequence length 331
Comment docking protein 6 [Macaca mulatta]; AA=GCF_000772875.2; RF=representative genome; TAX=9544; STAX=9544; NAME=Macaca mulatta; AL=Chromosome; RT=Major
Sequence
MASNFNDIVKQGYVKIRSRKLGIFRRCWLVFKKASSKGPRRLEKFPDEKAAYFRNFHKVT
ELHNIKNITRLPRETKKHAVAIIFHDETSKTFACESELEAEEWCKHLCMECLGTRLNDIS
LGEPDLLAAGVQREQNERFNVYLMPTPNLDIYGECTMQITHENIYLWDIHNAKVKLVMWP
LSSLRRYGRDSTWFTFESGRMCDTGEGLFTFQTREGEMIYQKVHSATLAIAEQHERLMLE
MEQKARLQTSLTEPMTLSKSISLPRSAYWHHITRQNSVGEIYSLQGHGFGSSKMSRAQTF
PSYAPEQSEEAQQPLSRSSSYGFSYSSSLIQ
Download sequence
Identical sequences A0A2I3M878 A0A2K5N875 A0A2K5W216 A0A2K6CIZ2 F7BCD1 G1RCZ4 G3QLB4 H2NWJ5 H2R6P9 Q6PKX4
ENSNLEP00000011093 ENSPPYP00000010359 9598.ENSPTRP00000049345 9600.ENSPPYP00000010359 9606.ENSP00000372160 ENSPTRP00000049345 NP_001252967.1.72884 NP_689934.2.87134 NP_689934.2.92137 XP_003264376.1.23891 XP_005586539.1.63531 XP_008012009.1.81039 XP_011731560.1.29376 XP_011823742.1.47321 XP_011924599.1.92194 XP_018869795.1.27298 XP_512169.2.37143 ENSMMUP00000041156 gi|47575849|ref|NP_689934.2| ENSPTRP00000049345 ENSP00000372160 ENSP00000372160 ENSPPYP00000010359 ENSP00000372160 ENSNLEP00000011093

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]