SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for NP_001253477.1.72884 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001253477.1.72884
Domain Number 1 Region: 20-184
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 8.52e-47
Family Dual specificity phosphatase-like 0.000000045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_001253477.1.72884
Sequence length 185
Comment dual specificity protein phosphatase 3 [Macaca mulatta]; AA=GCF_000772875.2; RF=representative genome; TAX=9544; STAX=9544; NAME=Macaca mulatta; AL=Chromosome; RT=Major
Sequence
MSGSFELSVQDLNDLLSDGSGCYSLPSQPCNEVTPRIYVGNASVAQDIPKLQKLGITHVL
NAAEGRSFMHVNTNANFYKDSGITYLGIKANDTQEFNLSAYFERAADFIDQALAQKNGRV
LVHCREGYSRSPTLVIAYLMMRQKMDVKSALSIVRQNREIGPNDGFLAQLCQLNDRLAKE
GKLKP
Download sequence
Identical sequences A0A096P164 A0A0D9S155 A0A2J8UY54 A0A2K5IY11 A0A2K5NA53 A0A2K5X2K0 A0A2K6DH25 A0A2K6KWJ5 A0A2K6PW96 F7C5I2 G3SGS9 H2RGU9 P51452 Q5RD73
ENSGGOP00000027316 NP_001125129.1.23681 NP_001253477.1.72884 NP_004081.1.87134 NP_004081.1.92137 XP_004041589.1.27298 XP_005584430.2.63531 XP_008010705.1.81039 XP_010374534.1.97406 XP_011718815.1.29376 XP_011795444.1.43180 XP_011795445.1.43180 XP_011913296.1.92194 XP_016787216.1.37143 XP_017748287.1.44346 ENSP00000226004 ENSGGOP00000027316 ENSP00000226004 ENSPPYP00000009390 gi|4758208|ref|NP_004081.1| DUSP3 ENSPPYP00000009390 9544.ENSMMUP00000003147 9598.ENSPTRP00000015742 9600.ENSPPYP00000009390 9606.ENSP00000226004 ENSPTRP00000060576 ENSMMUP00000003147 ENSPTRP00000060747 ENSMMUP00000003147 ENSPANP00000019089 ENSP00000226004

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]