SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for NP_001260462.1.81976 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001260462.1.81976
Domain Number 1 Region: 172-276
Classification Level Classification E-value
Superfamily TPR-like 0.00000312
Family Tetratricopeptide repeat (TPR) 0.013
Further Details:      
 
Weak hits

Sequence:  NP_001260462.1.81976
Domain Number - Region: 352-396
Classification Level Classification E-value
Superfamily HIT/MYND zinc finger-like 0.000837
Family MYND zinc finger 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_001260462.1.81976
Sequence length 882
Comment down and out, isoform B [Drosophila melanogaster]; AA=GCF_000001215.4; RF=reference genome; TAX=7227; STAX=7227; NAME=Drosophila melanogaster; AL=Chromosome; RT=Major
Sequence
MASSTSSARGNNKAATTNTTAATAPVSTASSAAVSGSGATSAAATASAPPAVTLSELIGQ
QLKHLNADELLHKDELQLLLLITPVQRQKLSRNLEDGDLEASTSAAPLSRPENGEEDDDL
IGAVGGLGISSPTTTKEPVLDFRPHVLKWFQHLRHQTGHFKSEEESRRLREAGNDSYRKE
RHPLKASDLFTEAIFLAPARNTLAAALAHANRSLVLFDCGLYAESYDDCLCALDLGYPEE
YLPLIKLRQAACALKLRNFALCEEHLHELLHIELNQVFEARTHELWHQCEVLKVERFEMA
VQTGDDLDINDSKAFEIAWLDNSSSLHTTRAVAKNALIFESEAVAMVPSGNCRVCDYCGI
TQFIPFPCIYCSNRLVVYCSRQCRFKHAAIHAVECFGHQIELFESFGEVFGMPRLLQLAF
RMLITGLPELLGHCRKKPTLSKLWSAINGGLQERQDIAYSAVLRLERLKEERPTDTVIAL
ALAAHILSIYLSKCTTFFDQLEKSLPTASRMSSAEWELLCAALLMRHIGQLRHRSLTACR
SFVLPADPHVFSPLNEFQLWAAPMRLQEGHLHLLAGEVAVVSYSVYPDTLNLCRHSCSST
ICAKFSGRTVTALALLDLPAGSGIYNCFAGGNFQQLPREERTKQLLESGIRCHCNACQLT
HSDDQFHKFHRYRCDNPNCMEIFTPNALPHAPSLRWWLSEEYTQPEFNGADLIMCPHCGE
YQKLEWFWAFTTSLIDCELIEERCKLYAAIERAENQLMDLHECKVALARLLLEQCLMVHR
EGATVLDDWEFNKLGSILRSVLPSVMAQYGGQSIEYVKYFSYFWDVMALSNYKCNDRELM
QMLNALEFIADEFKDIFINYYEDYIAPKFAEESYGSVVDTQV
Download sequence
Identical sequences Q9V3J9
FBpp0080267 NP_001260462.1.81976 NP_609742.1.81976 FBpp0080267 FBpp0080267 7227.FBpp0080267

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]