SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for NP_001265869.1.87134 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001265869.1.87134
Domain Number 1 Region: 269-326
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), beta-barrel domain 1.1e-22
Family Transcription factor IIA (TFIIA), beta-barrel domain 0.0000596
Further Details:      
 
Weak hits

Sequence:  NP_001265869.1.87134
Domain Number - Region: 229-274
Classification Level Classification E-value
Superfamily ARM repeat 0.00489
Family GUN4-associated domain 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_001265869.1.87134
Sequence length 326
Comment transcription initiation factor IIA subunit 1 isoform 3 [Homo sapiens]; AA=GCF_000306695.2; RF=na; TAX=9606; STAX=9606; NAME=Homo sapiens; AL=Chromosome; RT=Major
Sequence
MQSRAVDGFHSEEQQLLLQVQQQHQPQQQQHHHHHHHQQAQPQQTVPQQAQTQQVLIPAS
QQATAPQVIVPDSKLIQHMNASNMSAAATAATLALPAGVTPVQQILTNSGQLLQVVRAAN
GAQYIFQPQQSVVLQQQVIPQMQPGGVQAPVIQQVLAPLPGGISPQTGVIIQPQQILFTG
NKTQVIPTTVAAPTPAQAQITATGQQQPQAQPAQTQAPLVLQVDGTGDTSSEEDEDEEED
YDDDEEEDKEKDGAEDGQVEEEPLNSEDDVSDEEGQELFDTENVVVCQYDKIHRSKNKWK
FHLKDGIMNLNGRDYIFSKAIGDAEW
Download sequence
Identical sequences A0A2I2YC53
NP_001265869.1.87134 NP_001265869.1.92137 XP_011804857.1.43180 XP_011825094.1.47321 XP_014999749.1.72884 XP_018865730.1.27298 XP_018865731.1.27298 XP_018865732.1.27298 XP_018865733.1.27298 XP_018865734.1.27298 ENSMMUP00000029130

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]