SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for NP_001270709.1.63531 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001270709.1.63531
Domain Number 1 Region: 6-274
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 2.35e-82
Family Capz alpha-1 subunit 0.00000355
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_001270709.1.63531
Sequence length 299
Comment F-actin-capping protein subunit alpha-3 [Macaca fascicularis]; AA=GCF_000364345.1; RF=representative genome; TAX=9541; STAX=9541; NAME=Macaca fascicularis; AL=Chromosome; RT=Major
Sequence
MTLSVLSRKDKERVIRRLLLQAPPGEFVNAFDDLCLLIRDEKLMHHQGECAGHQHCQKYS
VPLCIDGNPVLLSHHNVMGDYRFFDHQSKLSFRYDLLQNQLKDIQSHGIIRNETEYLRVV
VLCALKLYVNDHYPKGNCNVLRKTVKSKEYLIACIEDHNYETGECWNGLWKSKWIFQVNP
FLTQVTGRIFVQAHFFRCVNLHIEISKDLKESLEIVNQAQLALSFARLVEEQENKFQAAV
LEELQELSNEALRKILRRDLPVTRTLIDWQRILSDLNLVMYPKLGYVIYSRSVLCNWII
Download sequence
Identical sequences A0A096MNB7 A0A2K5L238 A0A2K5XET9 A0A2K6B666 G7N6G6 G7PJZ7 Q4R7M8
NP_001270709.1.63531 XP_011739251.1.29376 XP_011830849.1.47321 XP_011913812.1.92194 ENSPANP00000001135

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]