SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001273453.1.87134 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  NP_001273453.1.87134
Domain Number - Region: 62-94
Classification Level Classification E-value
Superfamily Histone-fold 0.0191
Family TBP-associated factors, TAFs 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_001273453.1.87134
Sequence length 103
Comment centromere protein W isoform a [Homo sapiens]; AA=GCF_000306695.2; RF=na; TAX=9606; STAX=9606; NAME=Homo sapiens; AL=Chromosome; RT=Major
Sequence
MALSTIVSQRKQIKRKAPRGFLKRVFKRKKPQLRLEKSGDLLVRFHPFSGWEWGTGEVHL
NCLLFVHRLAEESRTNACASKCRVINKEHVLAAAKVILKKSRG
Download sequence
Identical sequences A0A2J8PTL1
ENSP00000357311 ENSP00000357308 ENSP00000357308 NP_001273453.1.87134 NP_001273453.1.92137 XP_008951208.1.60992 ENSPTRP00000049651 ENSPTRP00000049651

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]