SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for NP_001273722.1.87134 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001273722.1.87134
Domain Number 1 Region: 124-305
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.57e-48
Family DBL homology domain (DH-domain) 0.000000287
Further Details:      
 
Domain Number 2 Region: 291-444
Classification Level Classification E-value
Superfamily PH domain-like 2.95e-47
Family Pleckstrin-homology domain (PH domain) 0.00000212
Further Details:      
 
Domain Number 3 Region: 51-132
Classification Level Classification E-value
Superfamily SH3-domain 2.76e-21
Family SH3-domain 0.00083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_001273722.1.87134
Sequence length 512
Comment spermatogenesis-associated protein 13 isoform 4 [Homo sapiens]; AA=GCF_000306695.2; RF=na; TAX=9606; STAX=9606; NAME=Homo sapiens; AL=Chromosome; RT=Major
Sequence
MVARGEIARFWSLESLHLVSSDGGTEPSALVDDNGSEEDFSYEDLCQASPRYLQPGGEQL
AINELISDGNVVCAEALWDHVTMDDQELGFKAGDVIQVLEASNKDWWWGRSEDKEAWFPA
SFVRGYIRQCRKHTGMFTVAQLATIFGNIEDIYKFQRKFLKDLEKQYNKEEPHLSEIGSC
FLQNQEGFAIYSEYCNNHPGACLELANLMKQGKYRHFFEACRLLQQMIDIAIDGFLLTPV
QKICKYPLQLAELLKYTTQEHGDYSNIKAAYEAMKNVACLINERKRKLESIDKIARWQVS
IVGWEGLDILDRSSELIHSGELTKITKQGKSQQRTFFLFDHQLVSCKKDLLRRDMLYYKG
RLDMDEMELVDLGDGRDKDCNLSVKNAFKLVSRTTDEVYLFCAKKQEDKARWLQACADER
RRVQEDKEMGMEISENQKKLAMLNAQKAGHGKSKGYNRCPVAPPHQGLHPIHQRHITMPT
SVPQQQVFGLAEPKRKSSLFWHTFNRLTPFRK
Download sequence
Identical sequences E9PFR9
ENSP00000386471 NP_001273722.1.87134 NP_001273722.1.92137 ENSP00000386471

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]