SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for NP_001278878.1.87134 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001278878.1.87134
Domain Number 1 Region: 2-345
Classification Level Classification E-value
Superfamily ADP-ribosylglycohydrolase 2.71e-87
Family ADP-ribosylglycohydrolase 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_001278878.1.87134
Sequence length 357
Comment ADP-ribosylarginine hydrolase isoform 1 [Homo sapiens]; AA=GCF_000306695.2; RF=na; TAX=9606; STAX=9606; NAME=Homo sapiens; AL=Chromosome; RT=Major
Sequence
MEKYVAAMVLSAAGDALGYYNGKWEFLQDGEKIHRQLAQLGGLDALDVGRWRVSDDTVMH
LATAEALVEAGKAPKLTQLYYLLAKHYQDCMEDMDGRAPGGASVHNAMQLKPGKPNGWRI
PFNSHEGGCGAAMRAMCIGLRFPHHSQLDTLIQVSIESGRMTHHHPTGYLGALASALFTA
YAVNSRPPLQWGKGLMELLPEAKKYIVQSGYFVEENLQHWSYFQTKWENYLKLRGILDGE
SAPTFPESFGVKERDQFYTSLSYSGWGGSSGHDAPMIAYDAVLAAGDSWKELAHRAFFHG
GDSDSTAAIAGCWWGVMYGFKGVSPSNYEKLEYRNRLEETARALYSLGSKEDTVISL
Download sequence
Identical sequences P54922
ENSP00000349496 ENSP00000417430 ENSP00000417528 ENSP00000420200 ENSP00000349496 ENSP00000417430 ENSP00000417528 ENSP00000420200 3hfw_A ENSP00000349496 gi|4557263|ref|NP_001116.1| 000139339|e3hfwA1|528.1.1.1|A:1-357 cath|current|3hfwA00/1-357 GO.34782 GO.57125 HR19 NP_001116.1.87134 NP_001116.1.92137 NP_001278878.1.87134 NP_001278878.1.92137 XP_011510740.1.92137 9606.ENSP00000349496

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]