SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for NP_001285439.1.81976 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001285439.1.81976
Domain Number 1 Region: 23-260,380-447
Classification Level Classification E-value
Superfamily TPR-like 1.88e-18
Family Tetratricopeptide repeat (TPR) 0.019
Further Details:      
 
Weak hits

Sequence:  NP_001285439.1.81976
Domain Number - Region: 658-714,752-789
Classification Level Classification E-value
Superfamily TPR-like 0.0467
Family Tetratricopeptide repeat (TPR) 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_001285439.1.81976
Sequence length 890
Comment N(alpha)-acetyltransferase 15/16, isoform B [Drosophila melanogaster]; AA=GCF_000001215.4; RF=reference genome; TAX=7227; STAX=7227; NAME=Drosophila melanogaster; AL=Chromosome; RT=Major
Sequence
MPSSDPLPPKEGALFRKLLKCYELKQYKNGLKLAKQILSNPKYMEHGETLAMKGLTLNGL
GRREEAYKYVRLGLRNDLRSHVCWHVYGLLQRSDKKYDEAIKCYRNALKWEKDNLQILKD
LSLLQIQMRDLEGYKETRHHLFTLRPSQHASWIGFAMSYHLLGDYDMANSILETFSQSQT
SIEAHDYRHSELLLYQNQILIESNRLQQAVDHLTKYQGQIVDKLAVRETMGDLYIKLQQQ
EKAVPIFESLIRRNPENVLYYEQYIAARQVTDSSAVVSIYRVFQEQYPRALCPRRLPLNI
ANGDEFRVVTDEYLRRGLRKGIPPLFVNVRTLHQIPERAAVIEELALQYFENLTRSGHFS
REDADAGIPVEPASALVWTALFLAQHYDYMRDTDRALEYINVAIDHTPTLIELLITKGRI
FKHAGDPVEAYVWLEEAQSMDTADRYINSKCAKYMLRANMVQEAEEICAKFTREGVSAMD
NLNEMQCMWFQTECALAYQRMGRWGESLKKCHEVERHFAEIVEDQFDFHTYCMRKMTLRA
YVGLLRLEDVLRQHPFYFKAAKCAIEVYIRLYDKPLKSETTIEEIDIENLPPSELKKLRS
KQRKAKKKAELESAQAAQAQVKREQHQKSKQQANQETDPDAPQLDELVAEKLERTDDPLD
KAIEFLKPLQQLAKERIETHLLAFELYYRKNKLLLMLQCIRRARAVDASHPVIHSCIIRF
VKSLTSAAKEQPFNEHVQQVLEKATKELIGSKTPQQLNDEFIAKHNASILHLYEGARSLY
ELDNSKKAAAIKLVTSFNLAKLRLEEATKIYTALRDGDVFGECEAEAASYQQACHQRFQY
ARIFRNVEELEAQLQEKEAAKLRAEEEQQQLIHVDSSEPVSVLATAAAAS
Download sequence
Identical sequences Q9VWI2
FBpp0074480 NP_001285439.1.81976 NP_573384.1.81976 FBpp0074480 7227.FBpp0074480 FBpp0074480

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]