SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for NP_001289438.1.87134 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001289438.1.87134
Domain Number 1 Region: 386-584
Classification Level Classification E-value
Superfamily Hemopexin-like domain 9.03e-69
Family Hemopexin-like domain 0.00000000174
Further Details:      
 
Domain Number 2 Region: 13-142,315-370
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 4.69e-38
Family Matrix metalloproteases, catalytic domain 0.000000305
Further Details:      
 
Domain Number 3 Region: 261-317
Classification Level Classification E-value
Superfamily Kringle-like 1.74e-21
Family Fibronectin type II module 0.0000635
Further Details:      
 
Domain Number 4 Region: 201-258
Classification Level Classification E-value
Superfamily Kringle-like 3.43e-21
Family Fibronectin type II module 0.0000526
Further Details:      
 
Domain Number 5 Region: 145-200
Classification Level Classification E-value
Superfamily Kringle-like 2.86e-20
Family Fibronectin type II module 0.0000528
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_001289438.1.87134
Sequence length 584
Comment 72 kDa type IV collagenase isoform 3 [Homo sapiens]; AA=GCF_000306695.2; RF=na; TAX=9606; STAX=9606; NAME=Homo sapiens; AL=Chromosome; RT=Major
Sequence
MQKFFGLPQTGDLDQNTIETMRKPRCGNPDVANYNFFPRKPKWDKNQITYRIIGYTPDLD
PETVDDAFARAFQVWSDVTPLRFSRIHDGEADIMINFGRWEHGDGYPFDGKDGLLAHAFA
PGTGVGGDSHFDDDELWTLGEGQVVRVKYGNADGEYCKFPFLFNGKEYNSCTDTGRSDGF
LWCSTTYNFEKDGKYGFCPHEALFTMGGNAEGQPCKFPFRFQGTSYDSCTTEGRTDGYRW
CGTTEDYDRDKKYGFCPETAMSTVGGNSEGAPCVFPFTFLGNKYESCTSAGRSDGKMWCA
TTANYDDDRKWGFCPDQGYSLFLVAAHEFGHAMGLEHSQDPGALMAPIYTYTKNFRLSQD
DIKGIQELYGASPDIDLGTGPTPTLGPVTPEICKQDIVFDGIAQIRGEIFFFKDRFIWRT
VTPRDKPMGPLLVATFWPELPEKIDAVYEAPQEEKAVFFAGNEYWIYSASTLERGYPKPL
TSLGLPPDVQRVDAAFNWSKNKKTYIFAGDKFWRYNEVKKKMDPGFPKLIADAWNAIPDN
LDAVVDLQGGGHSYFFKGAYYLKLENQSLKSVKFGSIKSDWLGC
Download sequence
Identical sequences G3RRS9
ENSP00000444143 ENSP00000461421 ENSP00000444143 ENSP00000461421 NP_001289437.1.87134 NP_001289437.1.92137 NP_001289438.1.87134 NP_001289438.1.92137 NP_001289439.1.87134 NP_001289439.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]