SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for NP_001303371.1.81976 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001303371.1.81976
Domain Number 1 Region: 700-905
Classification Level Classification E-value
Superfamily TPR-like 1.44e-28
Family HAT/Suf repeat 0.045
Further Details:      
 
Domain Number 2 Region: 493-703
Classification Level Classification E-value
Superfamily TPR-like 4.55e-25
Family Tetratricopeptide repeat (TPR) 0.013
Further Details:      
 
Domain Number 3 Region: 403-488
Classification Level Classification E-value
Superfamily TPR-like 0.000000000783
Family Tetratricopeptide repeat (TPR) 0.028
Further Details:      
 
Weak hits

Sequence:  NP_001303371.1.81976
Domain Number - Region: 279-340
Classification Level Classification E-value
Superfamily TPR-like 0.000201
Family Tetratricopeptide repeat (TPR) 0.038
Further Details:      
 
Domain Number - Region: 355-405
Classification Level Classification E-value
Superfamily TPR-like 0.000721
Family HAT/Suf repeat 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_001303371.1.81976
Sequence length 931
Comment CG6841, isoform B [Drosophila melanogaster]; AA=GCF_000001215.4; RF=reference genome; TAX=7227; STAX=7227; NAME=Drosophila melanogaster; AL=Chromosome; RT=Major
Sequence
MSNITAAVIANRNKKHFLGVPAPLGYVAGVGRGATGFTTRSDIGPARDANDVSDDRHAPP
ATKRKKKDEEEEEDEDLNDSNYDEFSGYSGSLFSKDPYDKDDEEADAIYDSIDKRMDEKR
KEYRDRRLREDLERYRQERPKIQQQFSDLKRSLASVTSEEWSTIPEVGDSRNRKQRNPRA
EKFTPLPDSLISRNLGGESSSTLDPSSGLASMVPGVATPGMLTPTGDLDLRKIGQARNTL
MNVKLSQVSDSVTGQTVVDPKGYLTDLQSMIPTYGGDINDIKKARLLLKSVRETNPNHPP
AWIASARLEEVTGKVQMARNLIMRGCEMNIQSEDLWLEAARLQPPDTAKAVIAQAARHIP
TSVRIWIKAADLESETKAKRRVFRKALEHIPNSVRLWKAAVELENPDDARILLSRAVECC
NTSVELWLALARLETYENARKVLNKARENIPTDRQIWTTAAKLEEANGNIHMVEKIIDRS
LTSLTVNGVEINRDQWFQEAIEAEKSGAVNCCQSIVKAVIGIGVEEEDRKQTWIDDAEFC
AKENAFECARAVYAHALQIFPSKKSIWLRAAYFEKNHGTRESLEALLQRAVAHCPKSEIL
WLMGAKSKWMAGDVPAARGILSLAFQANPNSEDIWLAAVKLESENSEYERARRLLAKARG
SAPTPRVMMKSARLEWALEKFDEALRLLEEAVEVFPDFPKLWMMKGQIEEQQRRTDDAAA
TYTLGLKKCPTSIPLWILSANLEERKGVLTKARSILERGRLRNPKVAVLWLEAIRVELRA
GLKEIASTMMARALQECPNAGELWAEAIFMETKPQRKTKSVDALKKCEHDPHVLLAVSKL
FWSEHKFSKCRDWFNRTVKIDPDLGDAWAYFYKFELLHGTEAQQQEVLDRCISAEPTHGE
SWCRVSKNIQNWQFKTPEVLRAVVRELSIPI
Download sequence
Identical sequences A0A0J9RY03 Q9VVU6
FBpp0074835 NP_001303371.1.81976 NP_649073.1.81976 XP_002085426.2.80810 7227.FBpp0074835 FBpp0074835 FBpp0074835

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]