SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for NP_001303491.1.81976 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001303491.1.81976
Domain Number 1 Region: 249-389
Classification Level Classification E-value
Superfamily TPR-like 0.000000000133
Family Tetratricopeptide repeat (TPR) 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_001303491.1.81976
Sequence length 635
Comment CCR4-NOT transcription complex subunit 10, isoform B [Drosophila melanogaster]; AA=GCF_000001215.4; RF=reference genome; TAX=7227; STAX=7227; NAME=Drosophila melanogaster; AL=Chromosome; RT=Major
Sequence
MDSAESPTKTQAGEDENYSLLCQAHEQFNNSEFDRCLELLQELETRGESSGPVLRHNRAV
VSYYKTGCTQHSVLLKELEALTADADAPGDVSSGLSLKQGAAAATVARYNRAVIYYHRHM
FGTALEKLAPLVARLEALEKAMAALVATLQLQLLLATNQLNRAEAFLDYLQYKLNLVATA
PSSNAAEEAAVVGTAPPSAATNSSVVASPGGAAVEGAVPGLGGSLQLLQLITLVLNRKPV
VIQEDGTPEYAALKAQQYYIMKDFQMAAKQLMRINNECTQAGTITPQLSTCIANNMGVIH
LRVRHYAIAAKFFQNALNFDQQLARNLRQSTLQTMSSARSCEILYNLGVAMLHLRRPKEA
FQCFLVPVKQFHSNPRLWLRMAEACIMEHEAKLVEEERQSQSETPSTKPYAPQSAGVPEP
TLEFAVLCLRSALTLTQHYKTRFHMAAVSSEDVEAPEPKDPTQESWRHPQDNNFCNPSKP
VSLESLENMMAAIYAAHSFVSLRLGDHVTALEMSEKLLACERLSDAHKLLGHMYAGEALM
LMDKASEARDHLDPTFVGTLNAFDFETRDWQLKSVDAAQNVVRYNLAVAMALQNDLPQAK
ALLANLTHSLVANKALALRRFMDLKMGPVPGGTPS
Download sequence
Identical sequences A0A126GUU0 Q9V3G6
FBpp0082112 NP_001303491.1.81976 NP_650215.1.81976 FBpp0082112 7227.FBpp0082112 FBpp0082112

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]