SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for NP_001305997.1.87134 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001305997.1.87134
Domain Number 1 Region: 57-193
Classification Level Classification E-value
Superfamily PH domain-like 0.00000523
Family Phosphotyrosine-binding domain (PTB) 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_001305997.1.87134
Sequence length 200
Comment integrin beta-1-binding protein 1 isoform 1 [Homo sapiens]; AA=GCF_000306695.2; RF=na; TAX=9606; STAX=9606; NAME=Homo sapiens; AL=Chromosome; RT=Major
Sequence
MFRKGKKRHSSSSSQSSEISTKSKSVDSSLGGLSRSSTVASLDTDSTKSSGQSNNNSDTC
AEFRIKYVGAIEKLKLSEGKGLEGPLDLINYIDVAQQDGKLPFVPPEEEFIMGVSKYGIK
VSTSDQYDVLHRHALYLIIRMVCYDDGLGAGKSLLALKTTDASNEEYSLWVYQCNSLEQA
QAICKVLSTAFDSVLTSEKP
Download sequence
Identical sequences A0A096NIU4 A0A2I3SE63 A0A2K5HEP1 A0A2K5MIQ6 A0A2K5YJ56 A0A2K6DYV8 A0A2K6M4N1 F7EVM2 G7PLK2 O14713
ENSP00000347504 ENSP00000353850 NP_001305995.1.87134 NP_001305995.1.92137 NP_001305996.1.87134 NP_001305996.1.92137 NP_001305997.1.87134 NP_001305997.1.92137 NP_004754.1.87134 NP_004754.1.92137 XP_003308922.1.37143 XP_003308923.1.37143 XP_003826992.1.60992 XP_005246240.1.92137 XP_005246241.1.92137 XP_005246242.1.92137 XP_005576650.1.63531 XP_005576651.1.63531 XP_005576652.1.63531 XP_006711966.1.92137 XP_008950541.1.60992 XP_008950542.1.60992 XP_009440255.1.37143 XP_009440257.1.37143 XP_011508718.1.92137 XP_011816322.1.43180 XP_011816323.1.43180 XP_011816324.1.43180 XP_011820707.1.47321 XP_011820708.1.47321 XP_011820709.1.47321 XP_011919301.1.92194 XP_011919302.1.92194 XP_011919303.1.92194 XP_011919304.1.92194 XP_011919305.1.92194 XP_011919306.1.92194 XP_011919307.1.92194 XP_014967154.1.72884 XP_014967155.1.72884 XP_014967156.1.72884 XP_014967157.1.72884 XP_014967158.1.72884 XP_014967160.1.72884 XP_014967161.1.72884 XP_014967162.1.72884 XP_014967163.1.72884 XP_014967164.1.72884 XP_014967165.1.72884 XP_014967166.1.72884 XP_015289492.1.63531 XP_015289493.1.63531 XP_015289494.1.63531 XP_015289495.1.63531 XP_015289497.1.63531 XP_015289498.1.63531 XP_015289499.1.63531 XP_015289500.1.63531 XP_015289501.1.63531 XP_015289502.1.63531 XP_015289503.1.63531 XP_015289504.1.63531 XP_016860756.1.92137 XP_016860757.1.92137 XP_017709028.1.44346 XP_017709037.1.44346 XP_017709045.1.44346 XP_017709052.1.44346 XP_017709061.1.44346 XP_017709065.1.44346 XP_017709069.1.44346 XP_017709077.1.44346 XP_017709086.1.44346 XP_017709095.1.44346 ENSP00000238091 ENSMMUP00000023700 ENSPANP00000012892 gi|4758578|ref|NP_004754.1| ENSMMUP00000023700 9544.ENSMMUP00000023700 9598.ENSPTRP00000020014 9606.ENSP00000347504 ENSP00000347504 ENSP00000353850 ENSPTRP00000020014 ENSPTRP00000020014

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]