SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001309893.1.87134 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001309893.1.87134
Domain Number 1 Region: 2-78
Classification Level Classification E-value
Superfamily FKBP-like 8.45e-29
Family FKBP immunophilin/proline isomerase 0.00000846
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_001309893.1.87134
Sequence length 79
Comment peptidyl-prolyl cis-trans isomerase FKBP1B isoform c [Homo sapiens]; AA=GCF_000306695.2; RF=na; TAX=9606; STAX=9606; NAME=Homo sapiens; AL=Chromosome; RT=Major
Sequence
MLQNGKKFDSSRDRNKPFKFRIGKQEVIKGFEEGAAQMSLGQRAKLTCTPDVAYGATGHP
GVIPPNATLIFDVELLNLE
Download sequence
Identical sequences A0A091CUY5 A0A287A967 A0A2F0B229 A0A2I3SVY4 A0A2J8VMD5 A0A2K5IPB0 A0A2K5ZAQ5 F8W6G9 M3WWK2
NP_001309892.1.87134 NP_001309892.1.92137 NP_001309893.1.87134 NP_001309893.1.92137 XP_006930520.2.62641 XP_008587336.1.73410 XP_008979323.1.60252 XP_009235767.1.23681 XP_009440383.1.37143 XP_010991241.1.51371 XP_011828106.1.47321 XP_011828107.1.47321 XP_014421514.1.101512 XP_014949735.1.66739 XP_016803629.1.37143 XP_016803630.1.37143 XP_016859082.1.92137 XP_016859083.1.92137 XP_016859084.1.92137 XP_016859085.1.92137 XP_017382258.1.71028 XP_017449823.1.100692 XP_017449824.1.100692 XP_017449825.1.100692 XP_017508371.1.32401 XP_018877005.1.27298 XP_018877006.1.27298 XP_019060196.1.5607 XP_019664334.1.58354 XP_019683404.1.62641 XP_020015307.1.5219 XP_020726145.1.74333 XP_020726146.1.74333 XP_020726147.1.74333 XP_020943438.1.46622 XP_021580324.1.77405 ENSP00000406593 ENSP00000406593

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]