SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for NP_001321563.1.80155 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001321563.1.80155
Domain Number 1 Region: 917-1056
Classification Level Classification E-value
Superfamily SET domain 5.89e-44
Family Histone lysine methyltransferases 0.0065
Further Details:      
 
Domain Number 2 Region: 307-412
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 4.39e-20
Family PWWP domain 0.0066
Further Details:      
 
Domain Number 3 Region: 620-693
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000000267
Family PHD domain 0.028
Further Details:      
 
Weak hits

Sequence:  NP_001321563.1.80155
Domain Number - Region: 731-770
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000107
Family PHD domain 0.063
Further Details:      
 
Domain Number - Region: 219-261
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.000361
Family Tudor domain 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_001321563.1.80155
Sequence length 1083
Comment trithorax-like protein 2 [Arabidopsis thaliana]; AA=GCF_000001735.3; RF=reference genome; TAX=3702; STAX=3702; NAME=Arabidopsis thaliana; ecotype=Columbia; AL=Chromosome; RT=Major
Sequence
MISMSCVPKEEEGEDTQIKTELHDHAADNPVRYASLESVYSVSSSSSSLCCKTAAGSHKK
VNALKLPMSDSFELQPHRRPEIVHVYCRRKRRRRRRRESFLELAILQNEGVERDDRIVKI
ESAELDDEKEEENKKKKQKKRRIGNGELMKLGVDSTTLSVSATPPLRGCRIKAVCSGNKQ
DGSSRSKRNTVKNQEKVVTASATAKKWVRLSYDGVDPKHFIGLQCKVFWPLDAVWYPGSI
VGYNVETKHHIVKYGDGDGEELALRREKIKFLISRDDMELLNMKFGTNDVVVDGQDYDEL
VILAASFEECQDFEPRDIIWAKLTGHAMWPAIIVDESVIVKRKGLNNKISGGRSVLVQFF
GTHDFARIQVKQAVSFLKGLLSRSPLKCKQPRFEEAMEEAKMYLKEYKLPGRMDQLQKVA
DTDCSERINSGEEDSSNSGDDYTKDGEVWLRPTELGDCLHRIGDLQIINLGRIVTDSEFF
KDSKHTWPEGYTATRKFISLKDPNASAMYKMEVLRDAESKTRPVFRVTTNSGEQFKGDTP
SACWNKIYNRIKKIQIASDNPDVLGEGLHESGTDMFGFSNPEVDKLIQGLLQSRPPSKVS
QRKYSSGKYQDHPTGYRPVRVEWKDLDKCNVCHMDEEYENNLFLQCDKCRMMVHTRCYGQ
LEPHNGILWLCNLCRPVALDIPPRCCLCPVVGGAMKPTTDGRWAHLACAIWIPETCLLDV
KKMEPIDGVKKVSKDRWKLLCSICGVSYGACIQCSNNTCRVAYHPLCARAAGLCVELADE
DRLFLLSMDDDEADQCIRLLSFCKRHRQTSNYHLETEYMIKPAHNIAEYLPPPNPSGCAR
TEPYNYLGRRGRKEPEALAGASSKRLFVENQPYIVGGYSRHEFSTYERIYGSKMSQITTP
SNILSMAEKYTFMKETYRKRLAFGKSGIHGFGIFAKLPHRAGDMVIEYTGELVRPPIADK
REHLIYNSMVGAGTYMFRIDNERVIDATRTGSIAHLINHSCEPNCYSRVISVNGDEHIII
FAKRDVAKWEELTYDYRFFSIDERLACYCGFPRCRGVVNDTEAEERQANIHASRCELKEW
TES
Download sequence
Identical sequences P0CB22
NP_001077464.4.80155 NP_001321563.1.80155 NP_001321564.1.80155 NP_172074.6.80155 AT1G05830.1 AT1G05830.1 AT1G05830.2 3702.AT1G05830.1-P

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]