SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for NP_001324862.1.80155 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001324862.1.80155
Domain Number 1 Region: 401-466
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000000000093
Family PHD domain 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_001324862.1.80155
Sequence length 631
Comment RING/FYVE/PHD zinc finger superfamily protein [Arabidopsis thaliana]; AA=GCF_000001735.3; RF=reference genome; TAX=3702; STAX=3702; NAME=Arabidopsis thaliana; ecotype=Columbia; AL=Chromosome; RT=Major
Sequence
MLVESSFSSSVETSLLNVSEYQDPFAAYDWTSLAESYQMIHKVPEQSQVSFLKNVPVTDT
MNLDESKHPKHQESCSEKSVMHKVSGKALTSLVYRRRKRTLIPGGTEEHNLGKIRKQDDS
LDDSIVSLYNPEESTKRKNRFNNCLVYSRKKRRGESSCTFTGETTIRGDGLDDAFVSEHD
CGETRRRGNRSDDCLVYSRKKGRVKFNSCSFSKHVTGRTKISYDQADSSACSQMGQIVKA
DSSLTRPKPGEIKKSGHQLVYSQRKQLVKSNGSFTESHVGKTKRNGDRSEVLLTYSRRKK
SGKSIGVRVNGFLVYTRKKLKFRGPFARRDLSETKKNGDQRSTVSSRELLDDTQVTEVTC
SSDGTNDSCSSLKSSSEVNSTSSKSREDDCYSSDSGVSETDTDGSSSPFRQCKHCDKPGT
VEKMLICDECEEAYHTRCCGVQMKDVAEIDEWLCPSCLKNQSSKTKTKGRISHERKWRVT
VPFVIGIRIGKMFQADVPDWSGPTMSDTSFVGEPLEIGQSEYMHDLKKAKNSKKQCSAVN
WLQCREEDTNGVICGKWRRAPRSEVQTKDWECFCCFSWDPSRADCAVPQELETSEILKQL
KYIKMLRPRSDAKKRKLGPKGRSRSHIKGKS
Download sequence
Identical sequences F4ISG1
AT2G19260.1 3702.AT2G19260.1-P AT2G19260.1 NP_001324862.1.80155 NP_179516.2.80155

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]