SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for NP_001326245.1.80155 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001326245.1.80155
Domain Number 1 Region: 718-769
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000000000354
Family PHD domain 0.0035
Further Details:      
 
Domain Number 2 Region: 913-1000
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 0.00000000236
Family N-acetyl transferase, NAT 0.012
Further Details:      
 
Weak hits

Sequence:  NP_001326245.1.80155
Domain Number - Region: 254-295
Classification Level Classification E-value
Superfamily DNA-binding domain 0.000183
Family Methyl-CpG-binding domain, MBD 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_001326245.1.80155
Sequence length 1189
Comment Acyl-CoA N-acyltransferase with RING/FYVE/PHD-type zinc finger protein [Arabidopsis thaliana]; AA=GCF_000001735.3; RF=reference genome; TAX=3702; STAX=3702; NAME=Arabidopsis thaliana; ecotype=Columbia; AL=Chromosome; RT=Major
Sequence
MLPGAEIEMLGGDCFEGSYEDHQIFREVFFGSDPGNTTKRCLVTGAINFECDSSKNVNSS
LSSNSVVTSGYACPQGFEASASRDGSDFNTKAKRVKLSGNKHLDARDEKGSALHGFPTSD
IARETIPLHLVESSNKGVSTSSYLLKHSIVKGREVYLGGIVSGKCKSLNLDKCDGKEFKA
IASPVSQESFATRMISVGASTPHSEKACFPLQLNNGSKVSPNELIMSKTCLKIDPKEDPR
PLLYKYVCKVLTAARWKIEKRERSAGRKHVDTFYISPEGRKFREFGSAWKALGGILLADR
KLMDTGTKKWTGINDFWSDLSLTLLDIEENMKNLNLANTRALWWSALEPFVVVVFISKQV
GSLRKGNKVEVARNSNPDKLKKEDTICLNLISGCPESVLTVSEGSHLVHDVDANQEIHSD
LEVQTKISSQKVSSRLERQSIIGKEISGTHEQEASKGIVASKLIAEDMHESVMRKNLHRR
SKKISDIKPASLDQHDSLDSNSLNSFEFQDKEMGNIHLVSKGSRDERLRNEKMNNSCCNS
KKGRKKARKHYTQDDDLMGSTITRNKGKFSRSSQKKKTQKPKARTKKRNNRGGCRLLPRS
SSNVENHFFQGNWSILGPRTVLSWLIATKVISRDEVIQLRDPDDDTVVKTGLVTKDGVVC
TCCNKTVSLSEFKNHAGFNQNCPCLNLFMGSGKPFASCQLEAWSAEYKARRNGWRLEKAS
DDDPNDDSCGVCGDGGELICCDNCPSTFHQACLSMQVLPEGSWYCSSCTCWICSELVSDN
AERSQDFKCSQCAHKYHGTCLQGISKRRKLFPETYFCGKNCEKVYNGLSSRVGIINPNAD
GLSWSILKCFQEDGMVHSARRLALKAECNSKLAVALSIMEESFLSMVDPRTGIDMIPHVL
YNWGSTFARLDFDGFYTVVVEKDDVMISVASIRVHGVTIAEMPLVATCSKYRRQGMCRIL
VAAIEEMLMSLKVEKLVVAALPSLVETWTEGFGFKPMDDEERDALKRINLMVFPGTTLLK
KTLYESTKPSTMKGVCLSKERNNPSNKEADLEPGLDKAGSPMSTQVESCDQMVPAGSDDE
PSPGFPVPLGADQTEPTSETENPSRDSNANDRPNKTTVVSIGEEEEEECLQKDVSKLSEE
GKETTRASSSSAALEEVSGLGLGVVNNVSDEMLLCVDEQLDSDSSQDSE
Download sequence
Identical sequences A0A178VFZ3 F4IXE7
3702.AT3G14980.1-P AT3G14980.1 AT3G14980.1 NP_001326242.1.80155 NP_001326245.1.80155 NP_188116.1.80155

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]