SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for NP_002733.2.87134 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_002733.2.87134
Domain Number 1 Region: 586-851
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.8e-81
Family Protein kinases, catalytic subunit 0.0000224
Further Details:      
 
Domain Number 2 Region: 423-541
Classification Level Classification E-value
Superfamily PH domain-like 4.01e-32
Family Pleckstrin-homology domain (PH domain) 0.0000138
Further Details:      
 
Domain Number 3 Region: 125-197
Classification Level Classification E-value
Superfamily Cysteine-rich domain 1.36e-20
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.00071
Further Details:      
 
Domain Number 4 Region: 262-321
Classification Level Classification E-value
Superfamily Cysteine-rich domain 6.88e-19
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_002733.2.87134
Sequence length 912
Comment serine/threonine-protein kinase D1 isoform 2 [Homo sapiens]; AA=GCF_000306695.2; RF=na; TAX=9606; STAX=9606; NAME=Homo sapiens; AL=Chromosome; RT=Major
Sequence
MSAPPVLRPPSPLLPVAAAAAAAAAALVPGSGPGPAPFLAPVAAPVGGISFHLQIGLSRE
PVLLLQDSSGDYSLAHVREMACSIVDQKFPECGFYGMYDKILLFRHDPTSENILQLVKAA
SDIQEGDLIEVVLSASATFEDFQIRPHALFVHSYRAPAFCDHCGEMLWGLVRQGLKCEGC
GLNYHKRCAFKIPNNCSGVRRRRLSNVSLTGVSTIRTSSAELSTSAPDEPLLQKSPSESF
IGREKRSNSQSYIGRPIHLDKILMSKVKVPHTFVIHSYTRPTVCQYCKKLLKGLFRQGLQ
CKDCRFNCHKRCAPKVPNNCLGEVTINGDLLSPGAESDVVMEEGSDDNDSERNSGLMDDM
EEAMVQDAEMAMAECQNDSGEMQDPDPDHEDANRTISPSTSNNIPLMRVVQSVKHTKRKS
STVMKEGWMVHYTSKDTLRKRHYWRLDSKCITLFQNDTGSRYYKEIPLSEILSLEPVKTS
ALIPNGANPHCFEITTANVVYYVGENVVNPSSPSPNNSVLTSGVGADVARMWEIAIQHAL
MPVIPKGSSVGTGTNLHRDISVSISVSNCQIQENVDISTVYQIFPDEVLGSGQFGIVYGG
KHRKTGRDVAIKIIDKLRFPTKQESQLRNEVAILQNLHHPGVVNLECMFETPERVFVVME
KLHGDMLEMILSSEKGRLPEHITKFLITQILVALRHLHFKNIVHCDLKPENVLLASADPF
PQVKLCDFGFARIIGEKSFRRSVVGTPAYLAPEVLRNKGYNRSLDMWSVGVIIYVSLSGT
FPFNEDEDIHDQIQNAAFMYPPNPWKEISHEAIDLINNLLQVKMRKRYSVDKTLSHPWLQ
DYQTWLDLRELECKIGERYITHESDDLRWEKYAGEQGLQYPTHLINPSASHSDTPETEET
EMKALGERVSIL
Download sequence
Identical sequences Q15139
NYSGRC-115529463 NP_002733.2.87134 NP_002733.2.92137 gi|115529463|ref|NP_002733.2| ENSP00000333568 ENSP00000482645 ENSP00000333568 9606.ENSP00000333568

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]