SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for NP_002882.3.87134 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_002882.3.87134
Domain Number 1 Region: 630-698,934-1270
Classification Level Classification E-value
Superfamily Ras GEF 5.1e-120
Family Ras GEF 0.0000103
Further Details:      
 
Domain Number 2 Region: 222-443
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.88e-44
Family DBL homology domain (DH-domain) 0.00023
Further Details:      
 
Domain Number 3 Region: 23-128
Classification Level Classification E-value
Superfamily PH domain-like 1.44e-19
Family Pleckstrin-homology domain (PH domain) 0.0051
Further Details:      
 
Domain Number 4 Region: 432-586
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000000067
Family Pleckstrin-homology domain (PH domain) 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_002882.3.87134
Sequence length 1273
Comment ras-specific guanine nucleotide-releasing factor 1 isoform 1 [Homo sapiens]; AA=GCF_000306695.2; RF=na; TAX=9606; STAX=9606; NAME=Homo sapiens; AL=Chromosome; RT=Major
Sequence
MQKGIRLNDGHVASLGLLARKDGTRKGYLSKRSSDNTKWQTKWFALLQNLLFYFESDSSS
RPSGLYLLEGCVCDRAPSPKPALSAKEPLEKQHYFTVNFSHENQKALELRTEDAKDCDEW
VAAIAHASYRTLATEHEALMQKYLHLLQIVETEKTVAKQLRQQIEDGEIEIERLKAEITS
LLKDNERIQSTQTVAPNDEDSDIKKIKKVQSFLRGWLCRRKWKTIIQDYIRSPHADSMRK
RNQVVFSMLEAEAEYVQQLHILVNNFLRPLRMAASSKKPPITHDDVSSIFLNSETIMFLH
QIFYQGLKARISSWPTLVLADLFDILLPMLNIYQEFVRNHQYSLQILAHCKQNRDFDKLL
KHYEAKPDCEERTLETFLTYPMFQIPRYILTLHELLAHTPHEHVERNSLDYAKSKLEELS
RIMHDEVSETENIRKNLAIERMIIEGCEILLDTSQTFVRQGSLIQVPMSEKGKITRGRLG
SLSLKKEGERQCFLFSKHLIICTRGSGGKLHLTKNGVISLIDCTLLEEPESTEEEAKGSG
QDIDHLDFKIGVEPKDSPPFTVILVASSRQEKAAWTSDISQCVDNIRCNGLMMNAFEENS
KVTVPQMIKRTREGTREAEMSRSDASLYCDDVDIRFSKTMNSCKVLQIRYASVERLLERL
TDLRFLSIDFLNTFLHSYRVFTTAIVVLDKLITIYKKPISAIPARWLRSLELLFASGQNN
KLLYGEPPKSPRATRKFSSPPPLSITKTSSPSRRRKLSLNIPIITGGKALDLAALSCNSN
GYTSMYSAMSPFSKATLDTSKLYVSSSFTNKIPDEGDTTPEKPEDPSALSKQSSEVSMRE
ESDIDQNQSDDGDTETSPTKSPTTPKSVKNKNSSEFPLFSYNNGVVMTSCRELDNNRSAL
SAASAFAIATAGANEGTPNKEKYRRMSLASAGFPPDQRNGDKEFVIRRAATNRVLNVLRH
WVSKHSQDFETNDELKCKVIGFLEEVMHDPELLTQERKAAANIIRTLTQEDPGDNQITLE
EITQMAEGVKAEPFENHSALEIAEQLTLLDHLVFKKIPYEEFFGQGWMKLEKNERTPYIM
KTTKHFNDISNLIASEIIRNEDINARVSAIEKWVAVADICRCLHNYNAVLEITSSMNRSA
IFRLKKTWLKVSKQTKALIDKLQKLVSSEGRFKNLREALKNCDPPCVPYLGMYLTDLAFI
EEGTPNYTEDGLVNFSKMRMISHIIREIRQFQQTAYKIEHQAKVTQYLLDQSFVMDEESL
YESSLRIEPKLPT
Download sequence
Identical sequences Q13972
ENSP00000378228 ENSP00000405963 ENSP00000405963 gi|24797099|ref|NP_002882.3| NP_002882.3.87134 NP_002882.3.92137 9606.ENSP00000405963

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]