SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for NP_004461.2.87134 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_004461.2.87134
Domain Number 1 Region: 31-136
Classification Level Classification E-value
Superfamily FKBP-like 8.54e-64
Family SCOPe 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_004461.2.87134
Sequence length 142
Comment peptidyl-prolyl cis-trans isomerase FKBP2 precursor [Homo sapiens]; AA=GCF_000306695.2; RF=na; TAX=9606; STAX=9606; NAME=Homo sapiens; AL=Chromosome; RT=Major
Sequence
MRLSWFRVLTVLSICLSAVATATGAEGKRKLQIGVKKRVDHCPIKSRKGDVLHMHYTGKL
EDGTEFDSSLPQNQPFVFSLGTGQVIKGWDQGLLGMCEGEKRKLVIPSELGYGERGAPPK
IPGGATLVFEVELLKIERRTEL
Download sequence
Identical sequences P26885 Q53XJ5
ENSP00000310935 9606.ENSP00000310935 4nnr_A 4nnr_B ENSP00000310935 ENSP00000378046 ENSP00000398147 ENSP00000310935 ENSP00000378046 ENSP00000398147 gi|17149842|ref|NP_004461.2| gi|17149844|ref|NP_476433.1| gi|206725530|ref|NP_001128680.1| NP_001128680.1.87134 NP_001128680.1.92137 NP_004461.2.87134 NP_004461.2.92137 NP_476433.1.87134 NP_476433.1.92137 XP_005273905.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]