SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for NP_004579.1.87134 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_004579.1.87134
Domain Number 1 Region: 34-142
Classification Level Classification E-value
Superfamily Immunoglobulin 5.37e-19
Family V set domains (antibody variable domain-like) 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_004579.1.87134
Sequence length 215
Comment sodium channel subunit beta-2 precursor [Homo sapiens]; AA=GCF_000306695.2; RF=na; TAX=9606; STAX=9606; NAME=Homo sapiens; AL=Chromosome; RT=Major
Sequence
MHRDAWLPRPAFSLTGLSLFFSLVPPGRSMEVTVPATLNVLNGSDARLPCTFNSCYTVNH
KQFSLNWTYQECNNCSEEMFLQFRMKIINLKLERFQDRVEFSGNPSKYDVSVMLRNVQPE
DEGIYNCYIMNPPDRHRGHGKIHLQVLMEEPPERDSTVAVIVGASVGGFLAVVILVLMVV
KCVRRKKEQKLSTDDLKTEEEGKTDGEGNPDDGAK
Download sequence
Identical sequences A0A2I3HIW5 O60939 Q5U0K8
ENSGGOP00000002064 gi|4759066|ref|NP_004579.1| ENSP00000278947 ENSNLEP00000008973 ENSP00000278947 9606.ENSP00000278947 ENSGGOP00000002064 NP_004579.1.87134 NP_004579.1.92137 XP_003253266.1.23891 ENSP00000278947 NYSGRC-IgSF-SCN2B_HUMAN ENSNLEP00000008973

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]