SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_004829.3.92137 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_004829.3.92137
Domain Number 1 Region: 5-143
Classification Level Classification E-value
Superfamily PH domain-like 3.58e-45
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.00000195
Further Details:      
 
Weak hits

Sequence:  NP_004829.3.92137
Domain Number - Region: 223-321
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0182
Family Spectrin repeat 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_004829.3.92137
Sequence length 361
Comment homer protein homolog 3 isoform 1 [Homo sapiens]; AA=GCF_000001405.37; RF=reference genome; TAX=9606; STAX=9606; NAME=Homo sapiens; AL=Chromosome; RT=Patch
Sequence
MSTAREQPIFSTRAHVFQIDPATKRNWIPAGKHALTVSYFYDATRNVYRIISIGGAKAII
NSTVTPNMTFTKTSQKFGQWADSRANTVYGLGFASEQHLTQFAEKFQEVKEAARLAREKS
QDGGELTSPALGLASHQVPPSPLVSANGPGEEKLFRSQSADAPGPTERERLKKMLSEGSV
GEVQWEAEFFALQDSNNKLAGALREANAAAAQWRQQLEAQRAEAERLRQRVAELEAQAAS
EVTPTGEKEGLGQGQSLEQLEALVQTKDQEIQTLKSQTGGPREALEAAEREETQQKVQDL
ETRNAELEHQLRAMERSLEEARAERERARAEVGRAAQLLDVSLFELSELREGLARLAEAA
P
Download sequence
Identical sequences Q9NSC5
NP_001139194.1.87134 NP_001139194.1.92137 NP_004829.3.87134 NP_004829.3.92137 XP_006723006.1.92137 XP_006723007.1.92137 9606.ENSP00000348150 gi|224809408|ref|NP_004829.3| gi|224809414|ref|NP_001139194.1| ENSP00000376162 ENSP00000439937 ENSP00000446026 HR4721 ENSP00000348150 ENSP00000376162 ENSP00000439937 ENSP00000446026

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]