SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for NP_008929.2.92137 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_008929.2.92137
Domain Number 1 Region: 14-188
Classification Level Classification E-value
Superfamily EF-hand 3.46e-23
Family Calmodulin-like 0.01
Further Details:      
 
Domain Number 2 Region: 152-270
Classification Level Classification E-value
Superfamily EF-hand 0.00000000000327
Family Calmodulin-like 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_008929.2.92137
Sequence length 276
Comment secretagogin [Homo sapiens]; AA=GCF_000001405.37; RF=reference genome; TAX=9606; STAX=9606; NAME=Homo sapiens; AL=Chromosome; RT=Patch
Sequence
MDSSREPTLGRLDAAGFWQVWQRFDADEKGYIEEKELDAFFLHMLMKLGTDDTVMKANLH
KVKQQFMTTQDASKDGRIRMKELAGMFLSEDENFLLLFRRENPLDSSVEFMQIWRKYDAD
SSGFISAAELRNFLRDLFLHHKKAISEAKLEEYTGTMMKIFDRNKDGRLDLNDLARILAL
QENFLLQFKMDACSTEERKRDFEKIFAYYDVSKTGALEGPEVDGFVKDMMELVQPSISGV
DLDKFREILLRHCDVNKDGKIQKSELALCLGLKINP
Download sequence
Identical sequences O76038
ENSP00000333933 gi|15055537|ref|NP_008929.2| ENSP00000367197 NP_008929.2.87134 NP_008929.2.92137 9606.ENSP00000367197 ENSP00000367197 GO.38466

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]