SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for NP_010737.1.97178 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_010737.1.97178
Domain Number 1 Region: 22-191
Classification Level Classification E-value
Superfamily TPR-like 0.0000000000000303
Family HAT/Suf repeat 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_010737.1.97178
Sequence length 440
Comment snoRNA-binding rRNA-processing protein UTP6 [Saccharomyces cerevisiae S288C]; AA=GCF_000146045.2; RF=reference genome; TAX=559292; STAX=4932; NAME=Saccharomyces cerevisiae S288C; strain=S288c; AL=Complete Genome; RT=Major
Sequence
MSKTRYYLEQCIPEMDDLVEKGLFTKNEVSLIMKKRTDFEHRLNSRGSSINDYIKYINYE
SNVNKLRAKRCKRILQVKKTNSLSDWSIQQRIGFIYQRGTNKFPQDLKFWAMYLNYMKAR
GNQTSYKKIHNIYNQLLKLHPTNVDIWISCAKYEYEVHANFKSCRNIFQNGLRFNPDVPK
LWYEYVKFELNFITKLINRRKVMGLINEREQELDMQNEQKNNQAPDEEKSHLQVPSTGDS
MKDKLNELPEADISVLGNAETNPALRGDIALTIFDVCMKTLGKHYINKHKGYYAISDSKM
NIELNKETLNYLFSESLRYIKLFDEFLDLERDYLINHVLQFWKNDMYDLSLRKDLPELYL
KTVMIDITLNIRYMPVEKLDIDQLQLSVKKYFAYISKLDSASVKSLKNEYRSYLQDNYLK
KMNAEDDPRYKILDLIISKL
Download sequence
Identical sequences B3LFL3 B5VGY0 C7GKP1 C8Z607 E7KM74 E7NGA5 H0GEP6 N1P7I7 Q02354
4932.YDR449C YDR449C YDR449C 355024 YDR449C NP_010737.1.97178 YDR449C SCRT_00090 YDR449C YDR449C YDR449C YDR449C YDR449C YDR449C YDR449C YDR449C YDR449C YDR449C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]