SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for NP_012036.1.97178 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_012036.1.97178
Domain Number 1 Region: 397-564
Classification Level Classification E-value
Superfamily TPR-like 4.27e-31
Family Tetratricopeptide repeat (TPR) 0.0088
Further Details:      
 
Domain Number 2 Region: 207-253,352-434
Classification Level Classification E-value
Superfamily TPR-like 0.0000019
Family Tetratricopeptide repeat (TPR) 0.039
Further Details:      
 
Domain Number 3 Region: 88-122,170-263
Classification Level Classification E-value
Superfamily TPR-like 0.0000372
Family Tetratricopeptide repeat (TPR) 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_012036.1.97178
Sequence length 626
Comment anaphase promoting complex subunit CDC23 [Saccharomyces cerevisiae S288C]; AA=GCF_000146045.2; RF=reference genome; TAX=559292; STAX=4932; NAME=Saccharomyces cerevisiae S288C; strain=S288c; AL=Complete Genome; RT=Major
Sequence
MNDDSQDKIIHDIRIQLRKAATELSRWKLYGSSKWAAEALAGLAEAIDVDQTHSLADESP
LRNKQGVPKQMFEIPQNGFGLSETEYDLYLLGSTLFDAKEFDRCVFFLKDVTNPYLKFLK
LYSKFLSWDKKSQESMENILTTGKFTDEMYRANKDGDGSGNEDINQSGHQRANLKMVSNE
HESQSNISSILKEINTFLESYEIKIDDDEADLGLALLYYLRGVILKQEKNISKAMSSFLK
SLSCYSFNWSCWLELMDCLQKVDDALLLNNYLYQNFQFKFSENLGSQRTIEFNIMIKFFK
LKVFEELNGQLEDYFEDLEFLLQVFPNFTFLKAYNATISYNNLDYVTAESRFDDIVKQDP
YRLNDLETYSNILYVMQKNSKLAYLAQFVSQIDRFRPETCCIIANYYSARQEHEKSIMYF
RRALTLDKKTTNAWTLMGHEFVELSNSHAAIECYRRAVDICPRDFKAWFGLGQAYALLDM
HLYSLYYFQKACTLKPWDRRIWQVLGECYSKTGNKVEAIKCYKRSIKASQTVDQNTSIYY
RLAQLYEELEDLQECKKFMMKCVDVEELLEGIVTDETVKARLWLAIFEIKAGNYQLAYDY
AMGVSSGTSQEIEEARMLARECRRHM
Download sequence
Identical sequences A0A0L8VPJ7 A0A250WKR5 A6ZT74 B3LST0 B5VK93 C8Z9W4 E7KDJ0 E7KPK5 E7LVK2 G2WFP0 N1P4U4 P16522
tr|A6ZT74|A6ZT74_YEAS7 SCRT_04879 YHR166C YHR166C YHR166C YR288 4932.YHR166C YHR166C YHR166C YHR166C YHR166C YHR166C YHR166C YHR166C YHR166C YHR166C YHR166C YHR166C NP_012036.1.97178 YHR166C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]