SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for NP_032745.2.92730 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_032745.2.92730
Domain Number 1 Region: 248-351
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.05e-21
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.00058
Further Details:      
 
Domain Number 2 Region: 6-78
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000000000144
Family HLH, helix-loop-helix DNA-binding domain 0.0032
Further Details:      
 
Domain Number 3 Region: 93-149
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000000432
Family Heme-binding PAS domain 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_032745.2.92730
Sequence length 816
Comment neuronal PAS domain-containing protein 2 [Mus musculus]; AA=GCF_000001635.25; RF=reference genome; TAX=10090; STAX=10090; NAME=Mus musculus; AL=Chromosome; RT=Patch
Sequence
MDEDEKDRAKRASRNKSEKKRRDQFNVLIKELSSMLPGNTRKMDKTTVLEKVIGFLQKHN
EVSAQTEICDIQQDWKPSFLSNEEFTQLMLEALDGFVIVVTTDGSIIYVSDSITPLLGHL
PADVMDQNLLNFLPEQEHSEVYKILSSHMLVTDSPSPEFLKSDNDLEFYCHLLRGSLNPK
EFPTYEYIKFVGNFRSYNNVPSPSCNGFDNTLSRPCHVPLGKDVCFIATVRLATPQFLKE
MCVADEPLEEFTSRHSLEWKFLFLDHRAPPIIGYLPFEVLGTSGYDYYHIDDLELLARCH
QHLMQFGKGKSCCYRFLTKGQQWIWLQTHYYITYHQWNSKPEFIVCTHSVVSYADVRVER
RQELALEDPPTEAMHPSAVKEKDSSLEPPQPFNALDMGASGLPSSPSPSASSRSSHKSSH
TAMSEPTSTPTKLMAENSTTALPRPATLPQELPVQGLSQAATMPTALHSSASCDLTKQLL
LQSLPQTGLQSPPAPVTQFSAQFSMFQTIKDQLEQRTRILQANIRWQQEELHKIQEQLCL
VQDSNVQMFLQQPAVSLSFSSTQRPAAQQQLQQRPAAPSQPQLVVNTPLQGQITSTQVTN
QHLLRESNVISAQGPKPMRSSQLLPASGRSLSSLPSQFSSTASVLPPGLSLTTIAPTPQD
DSQCQPSPDFGHDRQLRLLLSQPIQPMMPGSCDARQPSEVSRTGRQVKYAQSQVMFPSPD
SHPTNSSASTPVLLMGQAVLHPSFPASRPSPLQPAQAQQQPPPYLQAPTSLHSEQPDSLL
LSTFSQQPGTLGYAATQSTPPQPPRPSRRVSRLSES
Download sequence
Identical sequences G3X9B7
NP_032745.2.92730 XP_011236754.1.92730 ENSMUSP00000054719 ENSMUSP00000054719 ENSMUSP00000054719

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]