SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_036457.1.92137 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_036457.1.92137
Domain Number 1 Region: 1-130
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 5.62e-51
Family Calponin-homology domain, CH-domain 0.00000037
Further Details:      
 
Domain Number 2 Region: 195-261
Classification Level Classification E-value
Superfamily EB1 dimerisation domain-like 3.07e-45
Family EB1 dimerisation domain-like 0.0000189
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_036457.1.92137
Sequence length 268
Comment microtubule-associated protein RP/EB family member 1 [Homo sapiens]; AA=GCF_000001405.37; RF=reference genome; TAX=9606; STAX=9606; NAME=Homo sapiens; AL=Chromosome; RT=Patch
Sequence
MAVNVYSTSVTSDNLSRHDMLAWINESLQLNLTKIEQLCSGAAYCQFMDMLFPGSIALKK
VKFQAKLEHEYIQNFKILQAGFKRMGVDKIIPVDKLVKGKFQDNFEFVQWFKKFFDANYD
GKDYDPVAARQGQETAVAPSLVAPALNKPKKPLTSSSAAPQRPISTQRTAAAPKAGPGVV
RKNPGVGNGDDEAAELMQQVNVLKLTVEDLEKERDFYFGKLRNIELICQENEGENDPVLQ
RIVDILYATDEGFVIPDEGGPQEEQEEY
Download sequence
Identical sequences K7ARF5 Q15691
gi|6912494|ref|NP_036457.1| ENSP00000364721 2r8uA 2r8u_A 2r8u_B NP_036457.1.87134 NP_036457.1.92137 XP_003814782.1.60992 XP_011526998.1.92137 XP_016793186.1.37143 XP_016793187.1.37143 XP_016793188.1.37143 Q15691 ENSP00000364721 ENSP00000364721 9606.ENSP00000364721

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]