SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for NP_038473.2.87134 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_038473.2.87134
Domain Number 1 Region: 111-213
Classification Level Classification E-value
Superfamily PLP-dependent transferases 0.000000000000842
Family Pyridoxal-dependent decarboxylase 0.098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_038473.2.87134
Sequence length 224
Comment glutamate decarboxylase 1 isoform GAD25 [Homo sapiens]; AA=GCF_000306695.2; RF=na; TAX=9606; STAX=9606; NAME=Homo sapiens; AL=Chromosome; RT=Major
Sequence
MASSTPSSSATSSNAGADPNTTNLRPTTYDTWCGVAHGCTRKLGLKICGFLQRTNSLEEK
SRLVSAFKERQSSKNLLSCENSDRDARFRRTETDFSNLFARDLLPAKNGEEQTVQFLLEV
VDILLNYVRKTFDRSTKVLDFHHPHQLLEGMEGFNLELSDHPESLEQILVDCRDTLKYGV
RTGHPRFFNQLSTGLDIIGLAGEWLTSTANTNMPSDMRECWLLR
Download sequence
Identical sequences A0A2I2Z879 A0A2I3M2B6 A0A2I3TNB3 A0A2J8VQR2 A0A2K5IPK6 A0A2K5L2H8 A0A2K5VUQ6 A0A2K6BBY3 F6W3Q6
ENSP00000341167 ENSP00000364421 3706 HR2542 ENSP00000341167 ENSP00000364421 gi|15451889|ref|NP_038473.2| NP_038473.2.87134 NP_038473.2.92137 XP_005246501.1.92137 XP_005573499.1.63531 XP_008976277.1.60992 XP_011801310.1.43180 XP_011847339.1.47321 XP_016859247.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]