SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for NP_046934.1.30429 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_046934.1.30429
Domain Number 1 Region: 1-59
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 0.000000000204
Family Phage repressors 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_046934.1.30429
Sequence length 71
Comment gp39 [Escherichia virus N15]; AA=GCF_000839625.1; RF=na; TAX=40631; STAX=40631; NAME=Escherichia virus N15; AL=Complete Genome; RT=Major
Sequence
MKPEELVRHFGDVEKAAVGVGVTPGAVYQWLQAGEIPPLRQSDIEVRTAYKLKSDFTSQR
MGKEGHNSGTK
Download sequence
Identical sequences Q37964
2hin_A 2hin_B 3qws_A 3qws_B Q37964_BPN15 NP_046934.1.30429 cath|current|2hinA00/1-66 cath|current|2hinB00/1-64 cath|current|3qwsA00/1-62 cath|current|3qwsB00/1-63 gi|9630499|ref|NP_046934.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]