SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_057048.2.87134 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_057048.2.87134
Domain Number 1 Region: 2-138
Classification Level Classification E-value
Superfamily EF-hand 5.39e-51
Family p25-alpha 0.000000323
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_057048.2.87134
Sequence length 176
Comment tubulin polymerization-promoting protein family member 3 [Homo sapiens]; AA=GCF_000306695.2; RF=na; TAX=9606; STAX=9606; NAME=Homo sapiens; AL=Chromosome; RT=Major
Sequence
MAASTDMAGLEESFRKFAIHGDPKASGQEMNGKNWAKLCKDCKVADGKSVTGTDVDIVFS
KVKGKSARVINYEEFKKALEELATKRFKGKSKEEAFDAICQLVAGKEPANVGVTKAKTGG
AVDRLTDTSRYTGSHKERFDESGKGKGIAGRQDILDDSGYVSAYKNAGTYDAKVKK
Download sequence
Identical sequences A0A024R702 Q9BW30
ENSP00000290942 ENSP00000377529 ENSP00000457275 ENSP00000462435 GO.35111 HR387 ENSP00000290942 ENSP00000290942 ENSP00000377529 ENSP00000457275 ENSP00000462435 gi|56676375|ref|NP_057224.2| gi|56676377|ref|NP_057048.2| 9606.ENSP00000290942 NP_057048.2.87134 NP_057048.2.92137 NP_057224.2.87134 NP_057224.2.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]