SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for NP_058712.2.4139 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_058712.2.4139
Domain Number 1 Region: 7-475
Classification Level Classification E-value
Superfamily PLP-dependent transferases 5.7e-144
Family Pyridoxal-dependent decarboxylase 0.000000000308
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_058712.2.4139
Sequence length 656
Comment histidine decarboxylase [Rattus norvegicus]; AA=GCF_000002265.2; RF=na; TAX=10116; STAX=10116; NAME=Rattus norvegicus; strain=BN; Sprague-Dawley; AL=Chromosome; RT=Major
Sequence
MMEPSEYREYQARGKEMVDYICQYLSTLRERQVTPNVKPGYLRAQIPSSAPEEPDSWDSI
FGDIEQIIMPGVVHWQSPHMHAYYPALTSWPSLLGDMLADAINCLGFTWASSPACTELEM
NIMDWLAKMLGLPDFFLHHHPSSQGGGVLQSTVSESTLIALLAARKNKILEMKAHEPNAD
ESSLNARLVAYASDQAHSSVEKAGLISLVKIKFLPVDDNFSLRGEALQKAIEEDKQQGLV
PVFVCATLGTTGVCAFDKLSELGPICAREGLWLHVDAAYAGTAFLCPELRGFLKGIEYAD
SFTFNPSKWMMVHFDCTGFWVKDKYKLQQTFSVNPIYLRHANSGVATDFMHWQIPLSRRF
RSIKLWFVIRSFGVKNLQAHVRHGTDMAKYFESLVRSDPVFEIPAERHLGLVVFRLKGPN
CLTESVLKEIAKTGQVFLIPATIQDKLIIRFTVTSQFTTKDDILRDWNLIREAANLVLSQ
HCTSQPSPRAKNLIPPPVTRDSKDLTNGLSLESVNEGGDDPVQVRKIFRLPGDSLETTMD
PFDDCFSEEASDTTKHKLSSFLFSYLSVQNKKKTMRSLSCNSMPMSAQKSPPPDASVKHG
GFFRARIFSGFPEEMMMMKKGGFKKLIKFYSVPSFPECSSQCGTLQLPCCPLQAMV
Download sequence
Identical sequences A1A5M4
NP_058712.2.100692 NP_058712.2.4139 ENSRNOP00000014142 10116.ENSRNOP00000014142

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]