SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for NP_058718.2.100692 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_058718.2.100692
Domain Number 1 Region: 138-380
Classification Level Classification E-value
Superfamily vWA-like 1.78e-84
Family Integrin A (or I) domain 0.000000206
Further Details:      
 
Domain Number 2 Region: 638-726
Classification Level Classification E-value
Superfamily Integrin beta tail domain 1.83e-21
Family Integrin beta tail domain 0.00099
Further Details:      
 
Domain Number 3 Region: 358-468
Classification Level Classification E-value
Superfamily Integrin domains 1.2e-20
Family Integrin domains 0.0012
Further Details:      
 
Domain Number 4 Region: 25-83
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000000288
Family Plexin repeat 0.0016
Further Details:      
 
Domain Number 5 Region: 596-636
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000586
Family Integrin beta EGF-like domains 0.0041
Further Details:      
 
Domain Number 6 Region: 554-592
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000893
Family Integrin beta EGF-like domains 0.0043
Further Details:      
 
Weak hits

Sequence:  NP_058718.2.100692
Domain Number - Region: 520-553
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0363
Family Integrin beta EGF-like domains 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_058718.2.100692
Sequence length 798
Comment integrin beta-1 precursor [Rattus norvegicus]; AA=GCF_000001895.5; RF=representative genome; TAX=10116; STAX=10116; NAME=Rattus norvegicus; strain=mixed; AL=Chromosome; RT=Major
Sequence
MNLQLVFWIGLISLICSVFGQTDKNRCLKANAKSCGECIQAGPNCGWCTNTTFLQEGMPT
SARCDDLEALKKKGCQPSDIENPRGSQTIKKNKNVTNRSKGMAEKLRPEDITQIQPQQLL
LKLRSGEPQKFTLKFKRAEDYPIDLYYLMDLSYSMKDDLENVKSLGTDLMNEMRRITSDF
RIGFGSFVEKTVMPYISTTPAKLRNPCTSEQNCTSPFSYKNVLSLTDRGEFFNELVGQQR
ISGNLDSPEGGFDAIMQVAVCGSLIGWRNVTRLLVFSTDAGFHFAGDGKLGGIVLPNDGQ
CHLENNVYTMSHYYDYPSIAHLVQKLSENNIQTIFAVTEEFQPVYKELKNLIPKSAVGTL
SGNSSNVIQLIIDAYNSLSSEVILENSKLPDGVTINYKSYCKNGVNGTGENGRKCSNISI
GDEVQFEISITANKCPNKESETIKIKPLGFTEEVEVVLQFICKCNCQSHGIPASPKCHEG
NGTFECGACRCNEGRVGRHCECSTDEVNSEDMDAYCRKENSSEICSNNGECVCGQCVCRK
RENTNEIYSGKFCECDNFNCDRSNGLICGGNGVCRCRVCECYPNYTGSACDCSLDTVPCV
ATNGQICNGRGICECGACKCTDPKFQGPTCETCQTCLGVCAEHKECVQCRAFNKGEKKDT
CAQECSHFNLTKVESREKLPQPVQVDPVTHCKEKDIDDCWFYFTYSVNSNGEAHVHVVET
PDCPTGPDIIPIVAGVVAGIVLIGLALLLIWKLLMIIHDRREFAKFEKEKMNAKWDTGEN
PIYKSAVTTVVNPKYEGK
Download sequence
Identical sequences A0A0G2JSK5
NP_058718.2.100692 NP_058718.2.4139 10116.ENSRNOP00000014785 ENSRNOP00000042187 ENSRNOP00000014785

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]