SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for NP_062541.3.87134 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_062541.3.87134
Domain Number 1 Region: 1163-1385
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 8.51e-63
Family DBL homology domain (DH-domain) 0.0000000251
Further Details:      
 
Domain Number 2 Region: 1385-1526
Classification Level Classification E-value
Superfamily PH domain-like 7.08e-31
Family Pleckstrin-homology domain (PH domain) 0.00000142
Further Details:      
 
Domain Number 3 Region: 1540-1660
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 2.98e-28
Family PLC-like (P variant) 0.0044
Further Details:      
 
Domain Number 4 Region: 1077-1161
Classification Level Classification E-value
Superfamily SH3-domain 2.89e-27
Family SH3-domain 0.00000321
Further Details:      
 
Domain Number 5 Region: 230-332
Classification Level Classification E-value
Superfamily EF-hand 4.29e-27
Family Eps15 homology domain (EH domain) 0.0028
Further Details:      
 
Domain Number 6 Region: 8-107
Classification Level Classification E-value
Superfamily EF-hand 6.23e-26
Family Eps15 homology domain (EH domain) 0.0019
Further Details:      
 
Domain Number 7 Region: 731-814
Classification Level Classification E-value
Superfamily SH3-domain 2.89e-21
Family SH3-domain 0.00000526
Further Details:      
 
Domain Number 8 Region: 842-931
Classification Level Classification E-value
Superfamily SH3-domain 3.54e-19
Family SH3-domain 0.0000161
Further Details:      
 
Domain Number 9 Region: 953-1014
Classification Level Classification E-value
Superfamily SH3-domain 6.04e-19
Family SH3-domain 0.0000294
Further Details:      
 
Domain Number 10 Region: 1022-1092
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000000108
Family SH3-domain 0.0000201
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_062541.3.87134
Sequence length 1670
Comment intersectin-2 isoform 3 [Homo sapiens]; AA=GCF_000306695.2; RF=na; TAX=9606; STAX=9606; NAME=Homo sapiens; AL=Chromosome; RT=Major
Sequence
MMAQFPTAMNGGPNMWAITSEERTKHDRQFDNLKPSGGYITGDQARNFFLQSGLPAPVLA
EIWALSDLNKDGKMDQQEFSIAMKLIKLKLQGQQLPVVLPPIMKQPPMFSPLISARFGMG
SMPNLSIPQPLPPAAPITSLSSATSGTNLPPLMMPTPLVPSVSTSSLPNGTASLIQPLPI
PYSSSTLPHGSSYSLMMGGFGGASIQKAQSLIDLGSSSSTSSTASLSGNSPKTGTSEWAV
PQPTRLKYRQKFNTLDKSMSGYLSGFQARNALLQSNLSQTQLATIWTLADVDGDGQLKAE
EFILAMHLTDMAKAGQPLPLTLPPELVPPSFRGGKQIDSINGTLPSYQKMQEEEPQKKLP
VTFEDKRKANYERGNMELEKRRQALMEQQQREAERKAQKEKEEWERKQRELQEQEWKKQL
ELEKRLEKQRELERQREEERRKDIERREAAKQELERQRRLEWERIRRQELLNQKNREQEE
IVRLNSKKKNLHLELEALNGKHQQISGRLQDVRLKKQTQKTELEVLDKQCDLEIMEIKQL
QQELQEYQNKLIYLVPEKQLLNERIKNMQFSNTPDSGVSLLHKKSLEKEELCQRLKEQLD
ALEKETASKLSEMDSFNNQLKELRETYNTQQLALEQLYKIKRDKLKEIERKRLELMQKKK
LEDEAARKAKQGKENLWKENLRKEEEEKQKRLQEEKTQEKIQEEERKAEEKQRKDKDTLK
AEEKKRETASVLVNYRALYPFEARNHDEMSFNSGDIIQVDEKTVGEPGWLYGSFQGNFGW
FPCNYVEKMPSSENEKAVSPKKALLPPTVSLSATSTSSEPLSSNQPASVTDYQNVSFSNL
TVNTSWQKKSAFTRTVSPGSVSPIHGQGQVVENLKAQALCSWTAKKDNHLNFSKHDIITV
LEQQENWWFGEVHGGRGWFPKSYVKIIPGSEVKREEPEALYAAVNKKPTSAAYSVGEEYI
ALYPYSSVEPGDLTFTEGEEILVTQKDGEWWTGSIGDRSGIFPSNYVKPKDQESFGSASK
SGASNKKPEIAQVTSAYVASGSEQLSLAPGQLILILKKNTSGWWQGELQARGKKRQKGWF
PASHVKLLGPSSERATPAFHPVCQVIAMYDYAANNEDELSFSKGQLINVMNKDDPDWWQG
EINGVTGLFPSNYVKMTTDSDPSQQWCADLQTLDTMQPIERKRQGYIHELIQTEERYMAD
LQLVVEVFQKRMAESGFLTEGEMALIFVNWKELIMSNTKLLKALRVRKKTGGEKMPVQMI
GDILAAELSHMQAYIRFCSCQLNGAALLQQKTDEDTDFKEFLKKLASDPRCKGMPLSSFL
LKPMQRITRYPLLIRSILENTPESHADHSSLKLALERAEELCSQVNEGVREKENSDRLEW
IQAHVQCEGLAEQLIFNSLTNCLGPRKLLHSGKLYKTKSNKELHGFLFNDFLLLTYMVKQ
FAVSSGSEKLFSSKSNAQFKMYKTPIFLNEVLVKLPTDPSSDEPVFHISHIDRVYTLRTD
NINERTAWVQKIKAASEQYIDTEKKKREKAYQARSQKTSGIGRLMVHVIEATELKACKPN
GKSNPYCEISMGSQSYTTRTIQDTLNPKWNFNCQFFIKDLYQDVLCLTLFDRDQFSPDDF
LGRTEIPVAKIRTEQESKGPMTRRLLLHEVPTGEVWVRFDLQLFEQKTLL
Download sequence
Identical sequences ENSP00000354561 ENSP00000354561 NP_062541.3.87134 NP_062541.3.92137 gi|194294523|ref|NP_062541.3|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]