SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for NP_067681.1.92137 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_067681.1.92137
Domain Number 1 Region: 71-209
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 0.00000000000000824
Family Toll/Interleukin receptor TIR domain 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_067681.1.92137
Sequence length 235
Comment TIR domain-containing adapter molecule 2 [Homo sapiens]; AA=GCF_000001405.37; RF=reference genome; TAX=9606; STAX=9606; NAME=Homo sapiens; AL=Chromosome; RT=Patch
Sequence
MGIGKSKINSCPLSLSWGKRHSVDTSPGYHESDSKKSEDLSLCNVAEHSNTTEGPTGKQE
GAQSVEEMFEEEAEEEVFLKFVILHAEDDTDEALRVQNLLQDDFGIKPGIIFAEMPCGRQ
HLQNLDDAVNGSAWTILLLTENFLRDTWCNFQFYTSLMNSVNRQHKYNSVIPMRPLNNPL
PRERTPFALQTINALEEESRGFPTQVERIFQESVYKTQQTIWKETRNMVQRQFIA
Download sequence
Identical sequences Q86XR7
ENSP00000415139 NP_067681.1.87134 NP_067681.1.92137 gi|33386674|ref|NP_067681.1| 9606.ENSP00000386341 ENSP00000415139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]