SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for NP_068518.1.100692 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_068518.1.100692
Domain Number 1 Region: 37-492
Classification Level Classification E-value
Superfamily PLP-dependent transferases 3.81e-127
Family Pyridoxal-dependent decarboxylase 0.00029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_068518.1.100692
Sequence length 493
Comment cysteine sulfinic acid decarboxylase isoform 1 [Rattus norvegicus]; AA=GCF_000001895.5; RF=representative genome; TAX=10116; STAX=10116; NAME=Rattus norvegicus; strain=mixed; AL=Chromosome; RT=Major
Sequence
MADSKPLRTLDGDPVAVEALLRDVFGIVVDEAIRKGTNASEKVCEWKEPEELKQLLDLEL
QSQGESRERILERCRAVIHYSVKTGHPRFFNQLFSGLDPHALAGRIITESLNTSQYTYEI
APVFVLMEEEVLKKLRALVGWNTGDGVFCPGGSISNMYAINLARFQRYPDCKQRGLRALP
PLALFTSKECHYSITKGAAFLGLGTDSVRVVKADERGKMIPEDLERQISLAEAEGSVPFL
VSATSGTTVLGAFDPLDAIADVCQRHGLWLHVDAAWGGSVLLSRTHRHLLDGIQRADSVA
WNPHKLLAAGLQCSALLLRDTSNLLKRCHGSQASYLFQQDKFYNVALDTGDKVVQCGRRV
DCLKLWLMWKAQGGQGLEWRIDQAFALTRYLVEEIKKREGFELVMEPEFVNVCFWFVPPS
LRGKKESPDYSQRLSQVAPVLKERMVKKGTMMIGYQPHGTRANFFRMVVANPILVQADID
FLLGELERLGQDL
Download sequence
Identical sequences Q64611
ENSRNOP00000016205 ENSRNOP00000016205 10116.ENSRNOP00000016205 NP_068518.1.100692 NP_068518.1.4139 XP_006242500.1.100692 XP_006242501.1.100692 XP_006242502.1.100692 XP_006242504.1.100692 XP_008764004.1.100692 XP_017450565.1.100692

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]