SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for NP_068526.1.4139 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_068526.1.4139
Domain Number 1 Region: 88-182
Classification Level Classification E-value
Superfamily PDZ domain-like 4.6e-30
Family PDZ domain 0.011
Further Details:      
 
Domain Number 2 Region: 9-63
Classification Level Classification E-value
Superfamily L27 domain 2.79e-23
Family L27 domain 0.0000532
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_068526.1.4139
Sequence length 207
Comment protein lin-7 homolog B [Rattus norvegicus]; AA=GCF_000002265.2; RF=na; TAX=10116; STAX=10116; NAME=Rattus norvegicus; strain=BN; Sprague-Dawley; AL=Chromosome; RT=Major
Sequence
MAALVEPLGLERDVSRAVELLERLQRSGELPPQKLQALQRVLQSRFCSAIREVYEQLYDT
LDITGSAEVRAHATAKATVAAFTASEGHAHPRVVELPKTDEGLGFNIMGGKEQNSPIYIS
RVIPGGVADRHGGLKRGDQLLSVNGVSVEGEHHEKAVELLKAAQGSVKLVVRYTPRVLEE
MEARFEKMRSARRRQQHHSYSSLESRG
Download sequence
Identical sequences Q9Z252
ENSRNOP00000028164 ENSRNOP00000028164 NP_068526.1.100692 NP_068526.1.4139 XP_006986333.1.50099 XP_008843250.1.79516 XP_021077735.1.100879 XP_021512309.1.76796 XP_021512312.1.76796 10116.ENSRNOP00000028164

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]