SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for NP_075217.1.4139 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_075217.1.4139
Domain Number 1 Region: 184-520
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.6e-81
Family Protein kinases, catalytic subunit 0.000000385
Further Details:      
 
Domain Number 2 Region: 30-181
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 4.71e-42
Family Regulator of G-protein signaling, RGS 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_075217.1.4139
Sequence length 575
Comment G protein-coupled receptor kinase 4 [Rattus norvegicus]; AA=GCF_000002265.2; RF=na; TAX=10116; STAX=10116; NAME=Rattus norvegicus; strain=BN; Sprague-Dawley; AL=Chromosome; RT=Major
Sequence
MELENFMANTLLLKARQGFTKKTGRSKKWRELLKLPPVSMCSDLRHSIEKDFSSLCDQQP
IGRLLFRQFCNTKPDLKRCIEFLDAAAEYEVTIEEEQREFGLSIYSRFFKENSEVSLPQI
PPDLVKECKCNLKQSSPSQNVFQDCAGVIYKYLSEKPFEEYQESTYYNRFLQWKWLERRP
VTKNTFRQYRVLGKGGFGEVCACQVRATGKMYACKKLEKKRIKKRKGEAMALNEKRILEK
LHSRFVVSLAYTYETKDALCLVLTIMNGGDLKYHIYNLGNPGFEEQRAVFYAAELCCGLE
DLQRERIVYRDLKPENILLDDHGHIRISDLGLALEIPEGEMVRGRVGTVGYMAPEIISHE
KYTFSPDWWGLGCLIYEMIAGHSPFRKYKEKVNREEMERRVKTETEEYSERFSENAKSIC
SMLLTKDPSKRLGCQSDGASAVKQHPIFKDINFSRLEANMLDPPFCPDPEAIYCKDILDI
GQFSVVKGVNLDTNDEIFYTQFATGCVTIPWQNEMIESGCFKDLNEYEDKGLSPLEKHKI
CSCILRPKRNFFHRLFRRAACLNIAHSEEREPTEH
Download sequence
Identical sequences P70507
10116.ENSRNOP00000015894 ENSRNOP00000015894 ENSRNOP00000015894 NP_075217.1.100692 NP_075217.1.4139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]