SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for NP_078943.1.92137 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_078943.1.92137
Domain Number 1 Region: 106-157
Classification Level Classification E-value
Superfamily Endosomal sorting complex assembly domain 0.0000948
Family VPS37 C-terminal domain-like 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_078943.1.92137
Sequence length 285
Comment vacuolar protein sorting-associated protein 37B [Homo sapiens]; AA=GCF_000001405.37; RF=reference genome; TAX=9606; STAX=9606; NAME=Homo sapiens; AL=Chromosome; RT=Patch
Sequence
MAGAGSEARFAGLSLVQLNELLEDEGQLTEMVQKMEETQNVQLNKEMTLASNRSLAEGNL
LYQPQLDTLKARLTQKYQELQVLFEAYQIKKTKLDRQSSSASLETLLALLQAEGAKIEED
TENMAEKFLDGELPLDSFIDVYQSKRKLAHMRRVKIEKLQEMVLKGQRLPQALAPLPPRL
PELAPTAPLPYPAPEASGPPAVAPRRIPPPPPPVPAGRLATPFTAAMSSGQAVPYPGLQC
PPLPPRVGLPTQQGFSSQFVSPYPPPLPQRPPPRLPPHQPGFILQ
Download sequence
Identical sequences A0A024RBU0 G3QQI9 Q9H9H4
9606.ENSP00000267202 ENSP00000267202 ENSGGOP00000004855 ENSGGOP00000004855 ENSP00000267202 gi|13375926|ref|NP_078943.1| ENSP00000267202 NP_078943.1.87134 NP_078943.1.92137 XP_004054120.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]