SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for NP_079044.2.87134 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  NP_079044.2.87134
Domain Number - Region: 57-89
Classification Level Classification E-value
Superfamily EF-hand 0.0397
Family EF-hand modules in multidomain proteins 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_079044.2.87134
Sequence length 598
Comment EF-hand and coiled-coil domain-containing protein 1 [Homo sapiens]; AA=GCF_000306695.2; RF=na; TAX=9606; STAX=9606; NAME=Homo sapiens; AL=Chromosome; RT=Major
Sequence
MEPVSTGAEAGMEGAGGDPYRRPARRTQWLLSALAHHYGLDRGVENEIVVLATGLDQYLQ
EVFHHLDCRGAGRLPRADFRALCAVLGLRAEGATTAGQAAGDGNSRDVTPGDAAAELATD
GDSDTDEEARLALRAEPPELTFRQFHARLCGYFGTRAGPRLPRGALSEHIETQIRLRRPR
RRRRPPCAPGPDSGPDCERVARLEEENSSLRELVEDLRAALQSSDARCLALQVGLWKSQA
STHEMGHGGPEAAVRELRQAQGALAAAEARAGRLRRGQAEVRRRAEEARQVVLRSLHRVR
ELEALAQQVPGLQRWVRRLEAELQRYRSEDSQLPTPQLANPEPGDKSNEPEDAGTRDPDP
TPEGAWQSDSSSGSRALDEVDEQLFRSVEGQAASDEEEVEEERWQEEKKTPAAEAKTLLA
RLSSCRGRCDDQTAEKLMTYFGHFGGANHAHTLGELEACIAMLVEQLRTQGCGGRTLGTS
EEEAELQQKVEENEHLRLELQMVETERVRLSLLEEKLVDVLQLLQRLRDLNISKRALGKI
LLSTLDAFRDPTHEGRPSPAAILDALHQALAACQLLRRQPSAPASAAAALTNPLLVSC
Download sequence
Identical sequences Q9HA90
gi|228008351|ref|NP_079044.2| ENSP00000414597 ENSP00000414597 ENSP00000420075 NP_079044.2.87134 NP_079044.2.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]