SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for NP_080755.2.92730 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_080755.2.92730
Domain Number 1 Region: 12-44
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000105
Family Retrovirus zinc finger-like domains 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_080755.2.92730
Sequence length 178
Comment zinc finger CCHC domain-containing protein 10 [Mus musculus]; AA=GCF_000001635.25; RF=reference genome; TAX=10090; STAX=10090; NAME=Mus musculus; AL=Chromosome; RT=Patch
Sequence
MATPMHRLIARRKAEANKQHVRCQKCLEFGHWTYECKGKRKYLHRPSRTAELKKALKEKE
NRLLLQSIGETNIEKKIKKKKRSKSVTSSSTSSSDSSASESSSESETSASSSSEDSDSDE
SLSSSSSSSSSSACSSSSSSSSSSSSSDSDSSSSSSSSSSSSESSSDDEPQKKKKKKK
Download sequence
Identical sequences Q9CX48
10090.ENSMUSP00000018383 ENSMUSP00000018383 ENSMUSP00000018383 ENSMUSP00000018383 NP_080755.2.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]