SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for NP_081585.2.92730 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_081585.2.92730
Domain Number 1 Region: 71-116
Classification Level Classification E-value
Superfamily LysM domain 0.00000000131
Family LysM domain 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_081585.2.92730
Sequence length 215
Comment lysM and putative peptidoglycan-binding domain-containing protein 2 [Mus musculus]; AA=GCF_000001635.25; RF=reference genome; TAX=10090; STAX=10090; NAME=Mus musculus; AL=Chromosome; RT=Patch
Sequence
MADLSPAPALREGGPRAHRPSAPSPPPRSRSTSEPEEAELSLSLARTKTRSYGSTASVRA
PLGAGVIERHVEHRVRAGDTLQGIALKYGVTMEQIKRANKLFTNDCIFLKKTLSIPILSE
KPLLFNGLNSIDSPESETVDSSFCQEEEPVVSEEELPPPSPQDPDPKPAQPEEVSARDFL
QRLDLQIKLSTQAARKLKEESRDEESPYAASLYHS
Download sequence
Identical sequences G3X915
ENSMUSP00000034702 10090.ENSMUSP00000034702 ENSMUSP00000034702 ENSMUSP00000034702 NP_081585.2.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]